StarFunc result for job id P17676

User Input

>input (345 residues)
MQRLVAWDPACLPLPPPPPAFKSMEVANFYYEADCLAAAYGGKAAPAAPPAARPGPRPPA
GELGSIGDHERAIDFSPYLEPLGAPQAPAPATATDTFEAAPPAPAPAPASSGQHHDFLSD
LFSDDYGGKNCKKPAEYGYVSLGRLGAAKGALHPGCFAPLHPPPPPPPPPAELKAEPGFE
PADCKRKEEAGAPGGGAGMAAGFPYALRAYLGYQAVPSGSSGSLSTSSSSSPPGTPSPAD
AKAPPTACYAGAAPAPSQVKSKAKKTVDKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQ
HKVLELTAENERLQKKVEQLSRELSTLRNLFKQLPEPLLASSGHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O15049	0.194	0.129	1.685E-2	544	0.200	0.127	O15049.pdb.gz	N4BP3_HUMAN NEDD4-binding protein 3 OS=Homo sapiens OX=9606 GN=N4BP3 PE=1 SV=3
2	AFDB:P84550	0.152	0.064	2.225E-2	965	0.226	0.081	P84550.pdb.gz	SKOR1_HUMAN SKI family transcriptional corepressor 1 OS=Homo sapiens OX=9606 GN=SKOR1 PE=1 SV=1
3	AFDB:Q9FJL4	0.102	0.073	3.880E-2	498	0.186	0.129	Q9FJL4.pdb.gz	BH078_ARATH Transcription factor bHLH78 OS=Arabidopsis thaliana OX=3702 GN=BHLH78 PE=1 SV=1
4	AFDB:Q5RH85	0.154	0.088	2.205E-1	653	0.200	0.106	Q5RH85.pdb.gz	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
5	AFDB:Q20435	0.164	0.098	2.716E-1	589	0.142	0.083	Q20435.pdb.gz	ATF6H_CAEEL Transcription factor atf-6 homolog OS=Caenorhabditis elegans OX=6239 GN=atf-6 PE=1 SV=2
6	AFDB:Q6DIC6	0.159	0.032	3.121E-1	2087	0.174	0.029	Q6DIC6.pdb.gz	Q6DIC6_MOUSE Tro protein OS=Mus musculus OX=10090 GN=Tro PE=1 SV=1
7	AFDB:O35451	0.188	0.112	6.253E-1	699	0.186	0.092	O35451.pdb.gz	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
8	AFDB:Q9UPS8	0.144	0.033	1.343	1710	0.168	0.034	Q9UPS8.pdb.gz	ANR26_HUMAN Ankyrin repeat domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ANKRD26 PE=1 SV=4
9	AFDB:O80588	0.172	0.128	1.543	474	0.122	0.089	O80588.pdb.gz	EDE1_ARATH Protein ENDOSPERM DEFECTIVE 1 OS=Arabidopsis thaliana OX=3702 GN=EDE1 PE=1 SV=1
10	AFDB:Q381R9	0.068	0.073	1.654	376	0.142	0.130	Q381R9.pdb.gz	Q381R9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.6820 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5Q8C6	0.0	660	346	0.986	0.983	E5Q8C6_PIG CCAAT/enhancer-binding protein OS=Sus scrofa OX=9823 GN=CEBPB PE=2 SV=1
2	P17676	0.0	682	345	1.000	1.000	CEBPB_HUMAN CCAAT/enhancer-binding protein beta OS=Homo sapiens OX=9606 GN=CEBPB PE=1 SV=2
3	Q05826	3.75e-100	300	328	0.629	0.662	CEBPB_CHICK CCAAT/enhancer-binding protein beta OS=Gallus gallus OX=9031 GN=CEBPB PE=1 SV=1
4	P28033	3.11e-89	271	296	0.661	0.770	CEBPB_MOUSE CCAAT/enhancer-binding protein beta OS=Mus musculus OX=10090 GN=Cebpb PE=1 SV=1
5	P21272	6.72e-88	268	297	0.661	0.768	CEBPB_RAT CCAAT/enhancer-binding protein beta OS=Rattus norvegicus OX=10116 GN=Cebpb PE=1 SV=1
6	Q7ZU07	6.78e-49	167	280	0.397	0.489	Q7ZU07_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=wu:fe11e05 PE=2 SV=1
7	O97894	1.50e-42	144	69	0.200	1.000	O97894_PIG CCAAT/enhancer binding protein beta (Fragment) OS=Sus scrofa OX=9823 GN=C/EBP beta PE=2 SV=1
8	Q7SZH5	9.19e-40	144	291	0.354	0.419	Q7SZH5_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=C/EBPbeta PE=2 SV=1
9	A5X2V9	9.90e-38	138	294	0.354	0.415	A5X2V9_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00073775001 PE=2 SV=1
10	Q90582	3.09e-35	132	324	0.304	0.324	Q90582_CHICK CCAAT/enhancer-binding protein OS=Gallus gallus OX=9031 GN=cC PE=3 SV=1
11	Q15744	1.97e-32	124	281	0.336	0.413	CEBPE_HUMAN CCAAT/enhancer-binding protein epsilon OS=Homo sapiens OX=9606 GN=CEBPE PE=1 SV=2
12	Q8UVZ1	4.92e-32	123	288	0.162	0.194	Q8UVZ1_DANRE CCAAT/enhancer-binding protein OS=Danio rerio OX=7955 GN=c/ebpa PE=2 SV=1
13	F1RNW6	8.06e-32	124	354	0.165	0.161	F1RNW6_PIG CCAAT enhancer binding protein alpha OS=Sus scrofa OX=9823 GN=CEBPA PE=3 SV=1
14	A5X2V8	2.96e-31	122	320	0.157	0.169	A5X2V8_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
15	Q6PZD9	2.38e-30	118	281	0.316	0.388	CEBPE_MOUSE CCAAT/enhancer-binding protein epsilon OS=Mus musculus OX=10090 GN=Cebpe PE=1 SV=1
16	P56261	3.46e-30	118	281	0.316	0.388	CEBPE_RAT CCAAT/enhancer-binding protein epsilon OS=Rattus norvegicus OX=10116 GN=Cebpe PE=1 SV=2
17	P49716	4.97e-28	112	269	0.154	0.197	CEBPD_HUMAN CCAAT/enhancer-binding protein delta OS=Homo sapiens OX=9606 GN=CEBPD PE=1 SV=2
18	A5X2W0	1.03e-27	112	304	0.162	0.184	A5X2W0_ONCMY CCAAT/enhancer-binding protein OS=Oncorhynchus mykiss OX=8022 GN=cebpd PE=2 SV=1
19	Q03484	1.13e-26	108	268	0.148	0.190	CEBPD_RAT CCAAT/enhancer-binding protein delta OS=Rattus norvegicus OX=10116 GN=Cebpd PE=2 SV=1
20	Q00322	3.18e-26	107	268	0.281	0.362	CEBPD_MOUSE CCAAT/enhancer-binding protein delta OS=Mus musculus OX=10090 GN=Cebpd PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	13	17.5	Autophagy protein 16 (ATG16)
2	PF00170 bZIP_1	0.18	23.2	bZIP transcription factor
3	PF07716 bZIP_2	3.1e-14	64.1	Basic region leucine zipper
4	PF15799 CCD48	95	12.8	Coiled-coil domain-containing protein 48
5	PF11932 DUF3450	73	14.1	Protein of unknown function (DUF3450)
6	PF09728 Taxilin	18	16.0	Myosin-like coiled-coil protein
7	PF06785 UPF0242	4e+02	12.5	Uncharacterised protein family (UPF0242) N-terminus

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305422

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263253	0.999	Histone acetyltransferase p300
2	9606.ENSP00000341551	0.998	Mothers against decapentaplegic homolog 4
3	9606.ENSP00000405330	0.998	Estrogen receptor
4	9606.ENSP00000287820	0.997	Peroxisome proliferator-activated receptor gamma
5	9606.ENSP00000332973	0.997	Mothers against decapentaplegic homolog 3
6	9606.ENSP00000362649	0.997	Histone deacetylase 1
7	9606.ENSP00000448665	0.997	DNA damage-inducible transcript 3 protein
8	9606.ENSP00000366915	0.995	Krueppel-like factor 5
9	9606.ENSP00000339992	0.994	Transcriptional activator Myb
10	9606.ENSP00000368880	0.992	Forkhead box protein O1
11	9606.ENSP00000270722	0.990	PR domain zinc finger protein 16
12	9606.ENSP00000360493	0.989	Runt-related transcription factor 2
13	9606.ENSP00000360266	0.986	Transcription factor AP-1
14	9606.ENSP00000265773	0.985	Probable global transcription activator SNF2L2
15	9606.ENSP00000344352	0.982	Cyclic AMP-dependent transcription factor ATF-3
16	9606.ENSP00000262367	0.981	CREB-binding protein
17	9606.ENSP00000385675	0.978	Interleukin-6
18	9606.ENSP00000427514	0.977	CCAAT/enhancer-binding protein alpha
19	9606.ENSP00000336790	0.976	Cyclic AMP-dependent transcription factor ATF-4
20	9606.ENSP00000387699	0.975	Cyclic AMP-responsive element-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1990837	0.999	sequence-specific double-stranded DNA binding
GO:0000976	0.976	transcription cis-regulatory region binding
GO:0140110	0.941	transcription regulator activity
GO:0003700	0.928	DNA-binding transcription factor activity
GO:0000977	0.858	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.792	cis-regulatory region sequence-specific DNA binding
GO:0000981	0.786	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042802	0.736	identical protein binding
GO:0001216	0.648	DNA-binding transcription activator activity
GO:0001228	0.632	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.449	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051173	0.997	positive regulation of nitrogen compound metabolic process
GO:0010604	0.997	positive regulation of macromolecule metabolic process
GO:0006355	0.996	regulation of DNA-templated transcription
GO:0031325	0.995	positive regulation of cellular metabolic process
GO:0045893	0.986	positive regulation of DNA-templated transcription
GO:0009987	0.942	cellular process
GO:0050896	0.933	response to stimulus
GO:0006357	0.801	regulation of transcription by RNA polymerase II
GO:0051716	0.712	cellular response to stimulus
GO:0048519	0.697	negative regulation of biological process
GO:0045944	0.554	positive regulation of transcription by RNA polymerase II
GO:0007154	0.498	cell communication
GO:0048523	0.482	negative regulation of cellular process
GO:0008152	0.469	metabolic process
GO:0023052	0.451	signaling
GO:0065009	0.448	regulation of molecular function
GO:0007165	0.431	signal transduction
GO:0006950	0.399	response to stress
GO:0044237	0.368	cellular metabolic process
GO:0071704	0.366	organic substance metabolic process
GO:0051239	0.361	regulation of multicellular organismal process
GO:0009892	0.346	negative regulation of metabolic process
GO:0044238	0.329	primary metabolic process
GO:0010605	0.328	negative regulation of macromolecule metabolic process
GO:0050793	0.302	regulation of developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.998	nucleoplasm
GO:0032991	0.993	protein-containing complex
GO:0005667	0.983	transcription regulator complex
GO:0140513	0.823	nuclear protein-containing complex
GO:0005737	0.608	cytoplasm
GO:0090575	0.582	RNA polymerase II transcription regulator complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]