StarFunc result for job id P17693

User Input

>input (338 residues)
MVVMAPRTLFLLLSGALTLTETWAGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRF
DSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQ
WMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQR
RAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILT
WQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQ
SSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17693	1.000	1.000	2.250E-66	338	1.000	1.000	P17693.pdb.gz	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
2	AFDB:P01889	0.932	0.873	6.473E-58	362	0.808	0.754	P01889.pdb.gz	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	AFDB:P04439	0.971	0.900	1.392E-57	365	0.828	0.767	P04439.pdb.gz	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
4	AFDB:P10321	0.920	0.852	6.443E-57	366	0.802	0.740	P10321.pdb.gz	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
5	AFDB:P01893	0.890	0.833	3.919E-56	362	0.796	0.743	P01893.pdb.gz	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
6	AFDB:P30511	0.922	0.902	8.431E-56	346	0.784	0.766	P30511.pdb.gz	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
7	AFDB:A0A583ZBW8	0.948	0.877	1.539E-55	366	0.808	0.746	A0A583ZBW8.pdb.gz	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
8	AFDB:P13747	0.847	0.801	1.889E-52	358	0.743	0.701	P13747.pdb.gz	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
9	AFDB:P01902	0.860	0.792	3.265E-52	368	0.657	0.603	P01902.pdb.gz	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
10	AFDB:Q95476	0.860	0.819	1.149E-51	355	0.704	0.670	Q95476.pdb.gz	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
11	PDB:6e1iA	0.809	0.704	2.650E-45	389	0.639	0.555	6e1iA.pdb.gz
12	PDB:6d7gA	0.799	0.701	2.799E-45	386	0.669	0.585	6d7gA.pdb.gz
13	PDB:5j6hA	0.804	0.986	3.468E-44	275	0.598	0.735	5j6hA.pdb.gz	Recognition of the Major Histocompatibility Complex (MHC) Class Ib Molecule H2-Q10 by the Natural Killer Cell Receptor Ly49C.
14	PDB:6mp0A	0.787	0.688	9.716E-42	388	0.562	0.490	6mp0A.pdb.gz
15	PDB:2qriA	0.789	0.673	1.145E-41	398	0.562	0.477	2qriA.pdb.gz
16	PDB:3nwmA	0.790	0.696	5.298E-41	384	0.580	0.510	3nwmA.pdb.gz
17	PDB:3es6A	0.658	0.783	3.368E-26	277	0.299	0.365	3es6A.pdb.gz	Crystal structure of the novel complex formed between zinc alpha2-glycoprotein (ZAG) and prolactin-inducible protein (PIP) from human seminal plasma
18	PDB:6fgbA	0.647	0.804	1.623E-22	265	0.216	0.275	6fgbA.pdb.gz
19	PDB:3ov6A	0.645	0.587	8.768E-20	376	0.186	0.168	3ov6A.pdb.gz	The 2.5 A structure of CD1c in complex with a mycobacterial lipid reveals an open groove ideally suited for diverse antigen presentation
20	PDB:1cd1A	0.621	0.745	1.352E-18	273	0.172	0.212	1cd1A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A583ZBW8	0.0	530	366	0.757	0.699	A0A583ZBW8_HUMAN HLA-C protein OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
2	P01889	0.0	530	362	0.763	0.713	HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain OS=Homo sapiens OX=9606 GN=HLA-B PE=1 SV=3
3	P01893	0.0	523	362	0.796	0.743	HLAH_HUMAN Putative HLA class I histocompatibility antigen, alpha chain H OS=Homo sapiens OX=9606 GN=HLA-H PE=5 SV=3
4	P04439	0.0	577	365	0.828	0.767	HLAA_HUMAN HLA class I histocompatibility antigen, A alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2
5	P10321	0.0	519	366	0.757	0.699	HLAC_HUMAN HLA class I histocompatibility antigen, C alpha chain OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=3
6	P13747	0.0	507	358	0.719	0.679	HLAE_HUMAN HLA class I histocompatibility antigen, alpha chain E OS=Homo sapiens OX=9606 GN=HLA-E PE=1 SV=4
7	P17693	0.0	705	338	1.000	1.000	HLAG_HUMAN HLA class I histocompatibility antigen, alpha chain G OS=Homo sapiens OX=9606 GN=HLA-G PE=1 SV=1
8	Q53YP1	0.0	539	366	0.766	0.708	Q53YP1_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
9	Q5RIP0	0.0	548	366	0.778	0.719	Q5RIP0_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
10	Q5SUL5	0.0	569	365	0.817	0.756	Q5SUL5_HUMAN HLA class I histocompatibility antigen OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1
11	Q7YQB1	0.0	520	366	0.772	0.713	Q7YQB1_HUMAN MHC class I antigen OS=Homo sapiens OX=9606 GN=HLA-C PE=1 SV=1
12	P30511	1.76e-180	504	346	0.784	0.766	HLAF_HUMAN HLA class I histocompatibility antigen, alpha chain F OS=Homo sapiens OX=9606 GN=HLA-F PE=1 SV=3
13	Q95476	7.14e-165	465	355	0.666	0.634	Q95476_BOVIN MHC Class I (Fragment) OS=Bos taurus OX=9913 GN=JSP.1 PE=2 SV=1
14	P06339	1.04e-157	447	357	0.645	0.611	HA15_MOUSE H-2 class I histocompatibility antigen, D-37 alpha chain OS=Mus musculus OX=10090 GN=H2-T23 PE=1 SV=1
15	P01898	6.20e-157	444	325	0.657	0.683	HA10_MOUSE H-2 class I histocompatibility antigen, Q10 alpha chain OS=Mus musculus OX=10090 GN=H2-Q10 PE=1 SV=3
16	P01897	6.96e-157	445	362	0.672	0.627	HA1L_MOUSE H-2 class I histocompatibility antigen, L-D alpha chain OS=Mus musculus OX=10090 GN=H2-L PE=1 SV=2
17	Q4KN81	2.14e-156	444	360	0.639	0.600	Q4KN81_MOUSE Histocompatibility 2, Q region locus 2 OS=Mus musculus OX=10090 GN=H2-Q2 PE=1 SV=1
18	P01902	5.22e-156	443	368	0.678	0.622	HA1D_MOUSE H-2 class I histocompatibility antigen, K-D alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
19	P01900	3.65e-154	439	365	0.657	0.608	HA12_MOUSE H-2 class I histocompatibility antigen, D-D alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
20	P01899	1.31e-152	434	362	0.657	0.613	HA11_MOUSE H-2 class I histocompatibility antigen, D-B alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07654 C1-set	2.4e-10	52.0	Immunoglobulin C1-set domain
2	PF08205 C2-set_2	35	15.9	CD80-like C2-set immunoglobulin domain
3	PF00047 ig	2.6e+02	13.2	Immunoglobulin domain
4	PF13927 Ig_3	2.8	19.9	Immunoglobulin domain
5	PF00129 MHC_I	3.5e-91	315.1	Class I Histocompatibility antigen, domains alpha 1 and 2
6	PF16497 MHC_I_3	1.7	19.6	MHC-I family domain
7	PF01174 SNO	3.8e+02	12.3	SNO glutamine amidotransferase family
8	PF03148 Tektin	3.5e+02	11.3	Tektin family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412927

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000315997	0.999	Leukocyte immunoglobulin-like receptor subfamily B member 1
2	9606.ENSP00000375629	0.999	Leukocyte immunoglobulin-like receptor subfamily B member 2
3	9606.ENSP00000452780	0.999	Beta-2-microglobulin
4	9606.ENSP00000339634	0.996	Killer cell immunoglobulin-like receptor 2DL4
5	9606.ENSP00000386559	0.988	T-cell surface glycoprotein CD8 alpha chain
6	9606.ENSP00000438038	0.985	NKG2-A/NKG2-B type II integral membrane protein
7	9606.ENSP00000375608	0.977	Killer cell immunoglobulin-like receptor 3DL1
8	9606.ENSP00000235933	0.975	CD160 antigen
9	9606.ENSP00000371333	0.968	Natural killer cells antigen CD94
10	9606.ENSP00000273183	0.946	SH3 and cysteine-rich domain-containing protein
11	9606.ENSP00000364016	0.938	Proteasome subunit beta type-8
12	9606.ENSP00000245414	0.932	Interferon regulatory factor 1
13	9606.ENSP00000325525	0.929	Killer cell immunoglobulin-like receptor 3DL2
14	9606.ENSP00000354394	0.925	Signal transducer and activator of transcription 1-alpha/beta
15	9606.ENSP00000380697	0.919	Interferon regulatory factor 7
16	9606.ENSP00000395590	0.912	Interferon-induced 35 kDa protein
17	9606.ENSP00000483430	0.911	Interferon alpha-inducible protein 27, mitochondrial
18	9606.ENSP00000252593	0.910	Bone marrow stromal antigen 2
19	9606.ENSP00000268638	0.910	Interferon regulatory factor 8
20	9606.ENSP00000360869	0.909	Interferon-induced protein with tetratricopeptide repeats 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003823	0.994	antigen binding
GO:0042277	0.992	peptide binding
GO:0042605	0.966	peptide antigen binding
GO:0005102	0.785	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.994	regulation of cellular process
GO:0048518	0.993	positive regulation of biological process
GO:0048519	0.989	negative regulation of biological process
GO:0002697	0.988	regulation of immune effector process
GO:0080134	0.987	regulation of response to stress
GO:0002831	0.987	regulation of response to biotic stimulus
GO:0050896	0.986	response to stimulus
GO:0002376	0.981	immune system process
GO:0048522	0.981	positive regulation of cellular process
GO:0009987	0.980	cellular process
GO:0050776	0.978	regulation of immune response
GO:0002684	0.972	positive regulation of immune system process
GO:0042269	0.971	regulation of natural killer cell mediated cytotoxicity
GO:0002683	0.961	negative regulation of immune system process
GO:0048002	0.958	antigen processing and presentation of peptide antigen
GO:0002708	0.958	positive regulation of lymphocyte mediated immunity
GO:0001914	0.955	regulation of T cell mediated cytotoxicity
GO:0050777	0.953	negative regulation of immune response
GO:0002698	0.951	negative regulation of immune effector process
GO:0031348	0.948	negative regulation of defense response
GO:0006955	0.945	immune response
GO:0032102	0.939	negative regulation of response to external stimulus
GO:0050778	0.938	positive regulation of immune response
GO:0002707	0.937	negative regulation of lymphocyte mediated immunity
GO:0048523	0.930	negative regulation of cellular process
GO:0006950	0.879	response to stress
GO:0051239	0.875	regulation of multicellular organismal process
GO:0001817	0.872	regulation of cytokine production
GO:0031343	0.853	positive regulation of cell killing
GO:0032501	0.847	multicellular organismal process
GO:0002833	0.841	positive regulation of response to biotic stimulus
GO:0002832	0.839	negative regulation of response to biotic stimulus
GO:0045824	0.826	negative regulation of innate immune response
GO:0050865	0.821	regulation of cell activation
GO:0001912	0.818	positive regulation of leukocyte mediated cytotoxicity
GO:0031349	0.816	positive regulation of defense response
GO:0051249	0.814	regulation of lymphocyte activation
GO:0001819	0.813	positive regulation of cytokine production
GO:0045089	0.797	positive regulation of innate immune response
GO:0031342	0.783	negative regulation of cell killing
GO:0002824	0.766	positive regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0001911	0.762	negative regulation of leukocyte mediated cytotoxicity
GO:0002711	0.736	positive regulation of T cell mediated immunity
GO:0002717	0.718	positive regulation of natural killer cell mediated immunity
GO:0051716	0.586	cellular response to stimulus
GO:0009605	0.471	response to external stimulus
GO:0006952	0.470	defense response
GO:0002700	0.451	regulation of production of molecular mediator of immune response
GO:0051707	0.445	response to other organism
GO:0002718	0.419	regulation of cytokine production involved in immune response
GO:0032502	0.387	developmental process
GO:0007154	0.386	cell communication
GO:0023052	0.385	signaling
GO:0007165	0.381	signal transduction
GO:0098542	0.314	defense response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0098588	0.999	bounding membrane of organelle
GO:0030659	0.999	cytoplasmic vesicle membrane
GO:0031984	0.997	organelle subcompartment
GO:0005783	0.997	endoplasmic reticulum
GO:0009986	0.996	cell surface
GO:0098553	0.991	lumenal side of endoplasmic reticulum membrane
GO:0030670	0.989	phagocytic vesicle membrane
GO:0032991	0.973	protein-containing complex
GO:0005769	0.884	early endosome
GO:0030135	0.837	coated vesicle
GO:0030662	0.829	coated vesicle membrane
GO:0030133	0.821	transport vesicle
GO:0012507	0.787	ER to Golgi transport vesicle membrane
GO:0010008	0.758	endosome membrane
GO:0055038	0.736	recycling endosome membrane
GO:0031901	0.734	early endosome membrane
GO:0005576	0.732	extracellular region
GO:0098796	0.624	membrane protein complex
GO:0005615	0.548	extracellular space
GO:0005794	0.522	Golgi apparatus
GO:0070062	0.515	extracellular exosome
GO:0000139	0.363	Golgi membrane
GO:0042611	0.360	MHC protein complex
GO:0009897	0.312	external side of plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]