StarFunc result for job id P17706

User Input

>input (415 residues)
MPTTIEREFEELDTQRRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQNAENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRIVEKES
VKCAQYWPTDDQEMLFKETGFSVKLLSEDVKSYYTVHLLQLENINSGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGSLNPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGD
DINIKQVLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKCIKGDSSIQKRWKELSKEDLSPA
FDHSPNKIMTEKYNGNRIGLEEEKLTGDRCTGLSSKMQDTMEENSESALRKRIREDRKAT
TAQKVQQMKQRLNENERKRKRWLYWQPILTKMGFMSVILVGAFVGWTLFFQQNAL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17706	1.000	1.000	1.576E-75	415	1.000	1.000	P17706.pdb.gz	PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=2
2	AFDB:P35233	0.765	0.763	4.290E-67	416	0.875	0.873	P35233.pdb.gz	PTN2_RAT Tyrosine-protein phosphatase non-receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ptpn2 PE=1 SV=2
3	AFDB:A8K3M3	0.716	0.683	5.577E-51	435	0.525	0.501	A8K3M3.pdb.gz	A8K3M3_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN1 PE=2 SV=1
4	AFDB:P20417	0.717	0.689	5.571E-50	432	0.513	0.493	P20417.pdb.gz	PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus OX=10116 GN=Ptpn1 PE=1 SV=1
5	AFDB:O13016	0.716	0.685	9.233E-50	434	0.518	0.495	O13016.pdb.gz	PTN1_CHICK Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus OX=9031 GN=PTPN1 PE=1 SV=1
6	AFDB:Q9W0G1	0.634	0.481	8.113E-35	548	0.407	0.308	Q9W0G1.pdb.gz	PTP61_DROME Tyrosine-protein phosphatase non-receptor type 61F OS=Drosophila melanogaster OX=7227 GN=Ptp61F PE=1 SV=1
7	AFDB:P29074	0.619	0.282	3.464E-27	926	0.231	0.104	P29074.pdb.gz	PTN4_HUMAN Tyrosine-protein phosphatase non-receptor type 4 OS=Homo sapiens OX=9606 GN=PTPN4 PE=1 SV=1
8	AFDB:P81718	0.606	0.415	9.513E-27	613	0.239	0.162	P81718.pdb.gz	PTN6_RAT Tyrosine-protein phosphatase non-receptor type 6 OS=Rattus norvegicus OX=10116 GN=Ptpn6 PE=1 SV=1
9	AFDB:E9Q0N2	0.623	0.272	1.006E-26	971	0.258	0.110	E9Q0N2.pdb.gz	PTPRH_MOUSE Receptor-type tyrosine-protein phosphatase H OS=Mus musculus OX=10090 GN=Ptprh PE=1 SV=1
10	AFDB:A0A2R8QL35	0.572	0.400	1.126E-26	599	0.255	0.177	A0A2R8QL35.pdb.gz
11	PDB:5xzrA	0.560	0.451	7.643E-26	519	0.231	0.185	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
12	PDB:4gwfA	0.622	0.523	1.340E-25	497	0.241	0.201	4gwfA.pdb.gz
13	PDB:3ps5A	0.578	0.457	1.499E-25	529	0.234	0.183	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:6krwA	0.605	0.809	8.522E-23	306	0.195	0.265	6krwA.pdb.gz
15	PDB:3m4uA	0.564	0.808	2.604E-17	285	0.171	0.249	3m4uA.pdb.gz
16	PDB:3s4oA	0.285	0.648	1.638E-4	163	0.072	0.184	3s4oA.pdb.gz
17	PDB:4ercA	0.236	0.548	1.104E-3	150	0.077	0.213	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
18	PDB:2gwoC	0.225	0.466	1.730E-3	174	0.065	0.155	2gwoC.pdb.gz
19	PDB:5xjvB	0.257	0.552	2.166E-3	171	0.067	0.164	5xjvB.pdb.gz
20	PDB:5bx1A	0.264	0.624	3.589E-3	153	0.084	0.229	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K3N4	0.0	801	387	0.918	0.984	A8K3N4_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTN2 PE=2 SV=1
2	D3DUJ3	0.0	662	316	0.761	1.000	D3DUJ3_HUMAN Protein tyrosine phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=1
3	K7EQG9	0.0	758	386	0.870	0.935	K7EQG9_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=1
4	P17706	0.0	874	415	1.000	1.000	PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=2
5	P35233	0.0	780	416	0.896	0.894	PTN2_RAT Tyrosine-protein phosphatase non-receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ptpn2 PE=1 SV=2
6	Q06180	0.0	774	406	0.887	0.906	PTN2_MOUSE Tyrosine-protein phosphatase non-receptor type 2 OS=Mus musculus OX=10090 GN=Ptpn2 PE=1 SV=2
7	A8K3M3	1.92e-161	463	435	0.564	0.538	A8K3M3_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN1 PE=2 SV=1
8	P18031	1.92e-161	463	435	0.564	0.538	PTN1_HUMAN Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1
9	P35821	7.64e-160	459	432	0.552	0.530	PTN1_MOUSE Tyrosine-protein phosphatase non-receptor type 1 OS=Mus musculus OX=10090 GN=Ptpn1 PE=1 SV=2
10	O13016	5.47e-159	457	434	0.552	0.528	PTN1_CHICK Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus OX=9031 GN=PTPN1 PE=1 SV=1
11	P20417	3.56e-158	454	432	0.554	0.532	PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus OX=10116 GN=Ptpn1 PE=1 SV=1
12	B4DSN5	2.33e-124	366	362	0.463	0.530	B4DSN5_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1
13	Q9W0G1	2.02e-91	288	548	0.342	0.259	PTP61_DROME Tyrosine-protein phosphatase non-receptor type 61F OS=Drosophila melanogaster OX=7227 GN=Ptp61F PE=1 SV=1
14	K7EIE9	2.20e-88	266	151	0.311	0.854	K7EIE9_HUMAN Protein tyrosine phosphatase non-receptor type 2 (Fragment) OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=1
15	Q8IRM6	8.25e-61	206	498	0.265	0.221	Q8IRM6_DROME Protein tyrosine phosphatase Meg2, isoform D OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
16	K7EIY0	1.84e-60	193	112	0.227	0.839	K7EIY0_HUMAN Protein tyrosine phosphatase non-receptor type 2 (Fragment) OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=1
17	Q59E68	4.33e-60	207	597	0.265	0.184	Q59E68_DROME Protein tyrosine phosphatase Meg2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
18	K7ENP9	1.68e-59	192	146	0.229	0.651	K7ENP9_HUMAN Protein tyrosine phosphatase non-receptor type 2 (Fragment) OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=1
19	Q8IRM7	6.91e-59	207	797	0.265	0.138	Q8IRM7_DROME LD30065p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
20	M9MS42	8.26e-59	207	790	0.265	0.139	M9MS42_DROME Protein tyrosine phosphatase Meg2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05227 CHASE3	63	14.9	CHASE3 domain
2	PF00782 DSPc	37	15.6	Dual specificity phosphatase, catalytic domain
3	PF12179 IKKbetaNEMObind	1.5e+02	13.6	I-kappa-kinase-beta NEMO binding domain
4	PF00957 Synaptobrevin	78	14.5	Synaptobrevin
5	PF00102 Y_phosphatase	2.2e-74	261.6	Protein-tyrosine phosphatase
6	PF13350 Y_phosphatase3	2.5e+02	13.1	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000311857

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354394	0.996	Signal transducer and activator of transcription 1-alpha/beta
2	9606.ENSP00000264657	0.995	Signal transducer and activator of transcription 3
3	9606.ENSP00000343204	0.987	Tyrosine-protein kinase JAK1
4	9606.ENSP00000275493	0.984	Epidermal growth factor receptor
5	9606.ENSP00000282588	0.983	Integrin alpha-1
6	9606.ENSP00000391592	0.976	Tyrosine-protein phosphatase non-receptor type 6
7	9606.ENSP00000391676	0.971	Tyrosine-protein kinase JAK3
8	9606.ENSP00000341208	0.968	Signal transducer and activator of transcription 5A
9	9606.ENSP00000293328	0.967	Signal transducer and activator of transcription 5B
10	9606.ENSP00000362680	0.963	Proto-oncogene tyrosine-protein kinase Src
11	9606.ENSP00000303830	0.961	Insulin receptor
12	9606.ENSP00000371067	0.960	Tyrosine-protein kinase JAK2
13	9606.ENSP00000401303	0.954	SHC-transforming protein 1
14	9606.ENSP00000300134	0.949	Signal transducer and activator of transcription 6
15	9606.ENSP00000380432	0.948	Insulin
16	9606.ENSP00000355923	0.944	Tyrosine-protein phosphatase non-receptor type 14
17	9606.ENSP00000394794	0.944	Tyrosine-protein phosphatase non-receptor type 13
18	9606.ENSP00000379350	0.941	Integrin beta-1
19	9606.ENSP00000265171	0.936	Pro-epidermal growth factor
20	9606.ENSP00000261799	0.933	Platelet-derived growth factor receptor beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004725	0.999	protein tyrosine phosphatase activity
GO:0019901	0.959	protein kinase binding
GO:0050839	0.922	cell adhesion molecule binding
GO:1990782	0.912	protein tyrosine kinase binding
GO:0005102	0.891	signaling receptor binding
GO:0000149	0.656	SNARE binding
GO:0030971	0.540	receptor tyrosine kinase binding
GO:0019905	0.434	syntaxin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050730	0.990	regulation of peptidyl-tyrosine phosphorylation
GO:0002683	0.987	negative regulation of immune system process
GO:0009968	0.986	negative regulation of signal transduction
GO:0051248	0.985	negative regulation of protein metabolic process
GO:0006470	0.985	protein dephosphorylation
GO:0060338	0.985	regulation of type I interferon-mediated signaling pathway
GO:0046426	0.981	negative regulation of receptor signaling pathway via JAK-STAT
GO:0060761	0.980	negative regulation of response to cytokine stimulus
GO:0050732	0.980	negative regulation of peptidyl-tyrosine phosphorylation
GO:0032102	0.979	negative regulation of response to external stimulus
GO:0031348	0.978	negative regulation of defense response
GO:0035335	0.960	peptidyl-tyrosine dephosphorylation
GO:0023052	0.957	signaling
GO:0051716	0.957	cellular response to stimulus
GO:0042509	0.945	regulation of tyrosine phosphorylation of STAT protein
GO:0002832	0.944	negative regulation of response to biotic stimulus
GO:0050777	0.939	negative regulation of immune response
GO:0001960	0.927	negative regulation of cytokine-mediated signaling pathway
GO:0007154	0.921	cell communication
GO:0002694	0.899	regulation of leukocyte activation
GO:0045824	0.897	negative regulation of innate immune response
GO:0045859	0.892	regulation of protein kinase activity
GO:0048518	0.889	positive regulation of biological process
GO:0007165	0.882	signal transduction
GO:0048522	0.858	positive regulation of cellular process
GO:0009893	0.852	positive regulation of metabolic process
GO:0010033	0.825	response to organic substance
GO:0071310	0.820	cellular response to organic substance
GO:0031325	0.816	positive regulation of cellular metabolic process
GO:0009719	0.797	response to endogenous stimulus
GO:0043086	0.793	negative regulation of catalytic activity
GO:0006469	0.778	negative regulation of protein kinase activity
GO:1902531	0.748	regulation of intracellular signal transduction
GO:0009967	0.747	positive regulation of signal transduction
GO:0071495	0.739	cellular response to endogenous stimulus
GO:0061097	0.720	regulation of protein tyrosine kinase activity
GO:0007166	0.692	cell surface receptor signaling pathway
GO:0050866	0.687	negative regulation of cell activation
GO:1902532	0.684	negative regulation of intracellular signal transduction
GO:0042127	0.682	regulation of cell population proliferation
GO:0080135	0.652	regulation of cellular response to stress
GO:1901700	0.634	response to oxygen-containing compound
GO:0032501	0.568	multicellular organismal process
GO:0042059	0.537	negative regulation of epidermal growth factor receptor signaling pathway
GO:0048856	0.515	anatomical structure development
GO:0008285	0.503	negative regulation of cell population proliferation
GO:0007167	0.498	enzyme-linked receptor protein signaling pathway
GO:0050793	0.468	regulation of developmental process
GO:0010468	0.460	regulation of gene expression
GO:0051173	0.448	positive regulation of nitrogen compound metabolic process
GO:0010604	0.443	positive regulation of macromolecule metabolic process
GO:0019219	0.363	regulation of nucleobase-containing compound metabolic process
GO:0009889	0.318	regulation of biosynthetic process
GO:0002376	0.314	immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0012505	0.995	endomembrane system
GO:0005654	0.995	nucleoplasm
GO:0016020	0.854	membrane
GO:0031982	0.803	vesicle
GO:0031410	0.581	cytoplasmic vesicle
GO:0071944	0.400	cell periphery
GO:0005886	0.381	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.999	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.999	protein-tyrosine-phosphatase.

[back to server]