StarFunc result for job id P17707

User Input

>input (334 residues)
MEAAHFFEGTEKLLEVWFSRQQPDANQGSGDLRTIPRSEWDILLKDVQCSIISVTKTDKQ
EAYVLSESSMFVSKRRFILKTCGTTLLLKALVPLLKLARDYSGFDSIQSFFYSRKNFMKP
SHQGYPHRNFQEEIEFLNAIFPNGAAYCMGRMNSDCWYLYTLDFPESRVISQPDQTLEIL
MSELDPAVMDQFYMKDGVTAKDVTRESGIRDLIPGSVIDATMFNPCGYSMNGMKSDGTYW
TIHITPEPEFSYVSFETNLSQTSYDDLIRKVVEVFKPGKFVTTLFVNQSSKCRTVLASPQ
KIEGFKRLDCQSAMFNDYNFVFTSFAKKQQQQQS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3Z6H8	0.996	0.996	9.544E-68	334	0.979	0.979	D3Z6H8.pdb.gz	DCAM2_MOUSE S-adenosylmethionine decarboxylase proenzyme 2 OS=Mus musculus OX=10090 GN=Amd2 PE=1 SV=1
2	PDB:1msvB	0.950	0.992	2.091E-61	320	0.955	0.997	1msvB.pdb.gz
3	AFDB:P91931	0.936	0.902	1.322E-45	347	0.485	0.467	P91931.pdb.gz	DCAM_DROME S-adenosylmethionine decarboxylase proenzyme OS=Drosophila melanogaster OX=7227 GN=SamDC PE=2 SV=1
4	AFDB:O02655	0.923	0.840	8.322E-42	368	0.422	0.383	O02655.pdb.gz	DCAM_CAEEL S-adenosylmethionine decarboxylase proenzyme OS=Caenorhabditis elegans OX=6239 GN=smd-1 PE=1 SV=1
5	AFDB:Q8T1E3	0.933	0.824	3.543E-41	379	0.395	0.348	Q8T1E3.pdb.gz	DCAM_DICDI S-adenosylmethionine decarboxylase proenzyme OS=Dictyostelium discoideum OX=44689 GN=amd1 PE=3 SV=3
6	AFDB:Q9P7E3	0.904	0.802	3.617E-36	378	0.395	0.349	Q9P7E3.pdb.gz	DCAM_SCHPO S-adenosylmethionine decarboxylase proenzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spe2 PE=2 SV=1
7	AFDB:Q96286	0.898	0.823	1.756E-33	366	0.347	0.317	Q96286.pdb.gz	DCAM1_ARATH S-adenosylmethionine decarboxylase proenzyme 1 OS=Arabidopsis thaliana OX=3702 GN=SAMDC1 PE=1 SV=2
8	AFDB:Q3E9D5	0.866	0.834	4.786E-33	347	0.338	0.326	Q3E9D5.pdb.gz	DCAM4_ARATH S-adenosylmethionine decarboxylase proenzyme 4 OS=Arabidopsis thaliana OX=3702 GN=SAMDC4 PE=1 SV=1
9	AFDB:P21182	0.877	0.745	6.324E-33	396	0.326	0.275	P21182.pdb.gz	DCAM_YEAST S-adenosylmethionine decarboxylase proenzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE2 PE=1 SV=1
10	AFDB:P50244	0.912	0.827	6.448E-31	370	0.257	0.232	P50244.pdb.gz	DCAMC_TRYBB S-adenosylmethionine decarboxylase proenzyme OS=Trypanosoma brucei brucei OX=5702 PE=1 SV=2
11	AFDB:A5HNV6	0.702	0.719	1.767E-18	325	0.165	0.169	A5HNV6.pdb.gz	DCAMP_TRYBB Inactive S-adenosylmethionine decarboxylase prozyme OS=Trypanosoma brucei brucei OX=5702 PE=1 SV=1
12	PDB:6bm7E	0.669	0.761	1.222E-16	291	0.150	0.172	6bm7E.pdb.gz	Species-Selective Pyrimidineamine Inhibitors of Trypanosoma brucei S-Adenosylmethionine Decarboxylase.
13	PDB:4iofB	0.175	0.082	1.507E-3	861	0.081	0.031	4iofB.pdb.gz	Conformational states and recognition of amyloidogenic peptides of human insulin-degrading enzyme.
14	PDB:3c6kD	0.196	0.189	7.174E-3	348	0.042	0.040	3c6kD.pdb.gz	Crystal structure of human spermine synthase: implications of substrate binding and catalytic mechanism.
15	PDB:7st9F	0.106	0.118	1.060E-2	293	0.087	0.099	7st9F.pdb.gz	Mechanisms of loading and release of the 9-1-1 checkpoint clamp.
16	PDB:3lx2A	0.119	0.151	1.324E-2	247	0.117	0.158	3lx2A.pdb.gz
17	PDB:4hk1A	0.115	0.146	1.480E-2	243	0.090	0.123	4hk1A.pdb.gz
18	PDB:5izrC	0.100	0.067	1.956E-2	659	0.060	0.030	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
19	PDB:6kncC	0.112	0.141	2.889E-2	249	0.093	0.124	6kncC.pdb.gz	Two conformations of DNA polymerase D-PCNA-DNA, an archaeal replisome complex, revealed by cryo-electron microscopy.
20	PDB:3a2fB	0.122	0.153	3.610E-2	247	0.090	0.121	3a2fB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z6H8	0.0	688	334	0.979	0.979	DCAM2_MOUSE S-adenosylmethionine decarboxylase proenzyme 2 OS=Mus musculus OX=10090 GN=Amd2 PE=1 SV=1
2	P0DMN7	0.0	691	334	0.982	0.982	DCAM1_MOUSE S-adenosylmethionine decarboxylase proenzyme 1 OS=Mus musculus OX=10090 GN=Amd1 PE=1 SV=1
3	P17707	0.0	699	334	1.000	1.000	DCAM_HUMAN S-adenosylmethionine decarboxylase proenzyme OS=Homo sapiens OX=9606 GN=AMD1 PE=1 SV=2
4	P17708	0.0	683	333	0.970	0.973	DCAM_RAT S-adenosylmethionine decarboxylase proenzyme OS=Rattus norvegicus OX=10116 GN=Amd1 PE=1 SV=3
5	P91931	1.68e-110	327	347	0.500	0.481	DCAM_DROME S-adenosylmethionine decarboxylase proenzyme OS=Drosophila melanogaster OX=7227 GN=SamDC PE=2 SV=1
6	O02655	1.39e-84	261	368	0.419	0.380	DCAM_CAEEL S-adenosylmethionine decarboxylase proenzyme OS=Caenorhabditis elegans OX=6239 GN=smd-1 PE=1 SV=1
7	Q8T1E3	9.26e-84	259	379	0.395	0.348	DCAM_DICDI S-adenosylmethionine decarboxylase proenzyme OS=Dictyostelium discoideum OX=44689 GN=amd1 PE=3 SV=3
8	Q9P7E3	1.91e-64	210	378	0.407	0.360	DCAM_SCHPO S-adenosylmethionine decarboxylase proenzyme OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=spe2 PE=2 SV=1
9	Q96286	4.74e-51	175	366	0.326	0.298	DCAM1_ARATH S-adenosylmethionine decarboxylase proenzyme 1 OS=Arabidopsis thaliana OX=3702 GN=SAMDC1 PE=1 SV=2
10	Q3E9D5	5.79e-45	158	347	0.338	0.326	DCAM4_ARATH S-adenosylmethionine decarboxylase proenzyme 4 OS=Arabidopsis thaliana OX=3702 GN=SAMDC4 PE=1 SV=1
11	P21182	6.39e-43	154	396	0.344	0.290	DCAM_YEAST S-adenosylmethionine decarboxylase proenzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPE2 PE=1 SV=1
12	P50244	1.71e-32	126	370	0.284	0.257	DCAMC_TRYBB S-adenosylmethionine decarboxylase proenzyme OS=Trypanosoma brucei brucei OX=5702 PE=1 SV=2
13	Q8IJ77	2.99e-06	51.6	1434	0.090	0.021	Q8IJ77_PLAF7 S-adenosylmethionine decarboxylase/ornithine decarboxylase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1033100 PE=3 SV=1
14	P31335	3.2	32.0	593	0.126	0.071	PUR9_CHICK Bifunctional purine biosynthesis protein ATIC OS=Gallus gallus OX=9031 GN=ATIC PE=1 SV=1
15	Q96D03	5.8	30.8	193	0.042	0.073	DDT4L_HUMAN DNA damage-inducible transcript 4-like protein OS=Homo sapiens OX=9606 GN=DDIT4L PE=1 SV=1
16	Q8K4L6	6.2	31.2	441	0.066	0.050	MEPE_MOUSE Matrix extracellular phosphoglycoprotein OS=Mus musculus OX=10090 GN=Mepe PE=1 SV=1
17	Q3EBC8	6.6	31.2	1388	0.066	0.016	DCL2_ARATH Endoribonuclease Dicer homolog 2 OS=Arabidopsis thaliana OX=3702 GN=At3g03300 PE=1 SV=2
18	Q9FLT5	6.7	31.2	950	0.069	0.024	AB9A_ARATH ABC transporter A family member 9 OS=Arabidopsis thaliana OX=3702 GN=ABCA9 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01536 SAM_decarbox	7.8e-120	411.7	Adenosylmethionine decarboxylase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357880

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000366156	0.995	Spermidine synthase
2	9606.ENSP00000385746	0.994	Spermine synthase
3	9606.ENSP00000234111	0.976	Ornithine decarboxylase
4	9606.ENSP00000361287	0.962	S-adenosylmethionine synthase isoform type-1
5	9606.ENSP00000303147	0.959	S-adenosylmethionine synthase isoform type-2
6	9606.ENSP00000325425	0.941	Methionine adenosyltransferase 2 subunit beta
7	9606.ENSP00000352516	0.920	DNA (cytosine-5)-methyltransferase 1
8	9606.ENSP00000264709	0.913	DNA (cytosine-5)-methyltransferase 3A
9	9606.ENSP00000294517	0.911	Antizyme inhibitor 2
10	9606.ENSP00000328547	0.910	DNA (cytosine-5)-methyltransferase 3B
11	9606.ENSP00000368572	0.810	Diamine acetyltransferase 1
12	9606.ENSP00000278060	0.792	Peroxisomal N(1)-acetyl-spermine/spermidine oxidase
13	9606.ENSP00000357863	0.791	General transcription factor 3C polypeptide 6
14	9606.ENSP00000478305	0.778	Spermine oxidase
15	9606.ENSP00000337180	0.774	Antizyme inhibitor 1
16	9606.ENSP00000463013	0.751	Ornithine decarboxylase antizyme 2
17	9606.ENSP00000210060	0.733	Deoxyhypusine synthase
18	9606.ENSP00000398882	0.727	Deoxyhypusine hydroxylase
19	9606.ENSP00000402338	0.716	Ribosome production factor 2 homolog
20	9606.ENSP00000364986	0.693	Agmatinase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004014	1.000	adenosylmethionine decarboxylase activity
GO:0005515	0.997	protein binding
GO:0042802	0.789	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.997	organonitrogen compound metabolic process
GO:1901566	0.992	organonitrogen compound biosynthetic process
GO:0044249	0.989	cellular biosynthetic process
GO:0034641	0.989	cellular nitrogen compound metabolic process
GO:0006595	0.989	polyamine metabolic process
GO:0044271	0.963	cellular nitrogen compound biosynthetic process
GO:0009309	0.870	amine biosynthetic process
GO:0042401	0.846	biogenic amine biosynthetic process
GO:0006596	0.822	polyamine biosynthetic process
GO:0008216	0.530	spermidine metabolic process
GO:0044238	0.361	primary metabolic process
GO:0008295	0.351	spermidine biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15981	1.000	H(+) + S-adenosyl-L-methionine = CO2 + S-adenosyl 3-(methylsulfanyl)propylamine
EC:4.1.1.50	1.000	adenosylmethionine decarboxylase.

[back to server]