StarFunc result for job id P17787

User Input

>input (502 residues)
MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQL
MVSLAQLISVHEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLY
NNADGMYEVSFYSNAVVSYDGSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDR
TEIDLVLKSEVASLDDFTPSGEWDIVALPGRRNENPDDSTYVDITYDFIIRRKPLFYTIN
LIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFLLLISKIVPPTSLDVPLVGKY
LMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQQPRHHCARQR
LRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQ
PLFQNYTTTTFLHSDHSAPSSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17787	1.000	1.000	2.250E-92	502	1.000	1.000	P17787.pdb.gz	ACHB2_HUMAN Neuronal acetylcholine receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=CHRNB2 PE=1 SV=1
2	AFDB:P09484	0.904	0.923	8.430E-80	491	0.815	0.833	P09484.pdb.gz	ACHB2_CHICK Neuronal acetylcholine receptor subunit beta-2 OS=Gallus gallus OX=9031 GN=CHRNB2 PE=1 SV=1
3	AFDB:A0A0R4ISQ3	0.842	0.806	6.328E-71	525	0.665	0.636	A0A0R4ISQ3.pdb.gz	A0A0R4ISQ3_DANRE Cholinergic receptor, nicotinic, beta 4 (neuronal) OS=Danio rerio OX=7955 GN=chrnb4 PE=3 SV=1
4	AFDB:P26153	0.822	0.877	2.961E-69	470	0.657	0.702	P26153.pdb.gz	ACHB4_CHICK Neuronal acetylcholine receptor subunit beta-4 (Fragment) OS=Gallus gallus OX=9031 GN=CHRNB4 PE=1 SV=1
5	AFDB:P12392	0.785	0.796	6.815E-67	495	0.616	0.624	P12392.pdb.gz	ACHB4_RAT Neuronal acetylcholine receptor subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Chrnb4 PE=1 SV=1
6	AFDB:P30926	0.784	0.790	5.203E-66	498	0.624	0.629	P30926.pdb.gz	ACHB4_HUMAN Neuronal acetylcholine receptor subunit beta-4 OS=Homo sapiens OX=9606 GN=CHRNB4 PE=1 SV=2
7	AFDB:P32297	0.778	0.774	1.115E-55	505	0.450	0.448	P32297.pdb.gz	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
8	AFDB:Q91X60	0.769	0.754	1.115E-55	512	0.466	0.457	Q91X60.pdb.gz	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1
9	AFDB:Q9R0W9	0.780	0.792	1.388E-55	494	0.442	0.449	Q9R0W9.pdb.gz	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
10	AFDB:P09481	0.814	0.823	2.836E-55	496	0.428	0.433	P09481.pdb.gz	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
11	PDB:4aq5E	0.560	0.731	3.244E-25	370	0.339	0.459	4aq5E.pdb.gz
12	PDB:6i53A	0.528	0.744	2.016E-21	349	0.120	0.172	6i53A.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
13	PDB:6i53B	0.518	0.749	2.251E-21	338	0.139	0.207	6i53B.pdb.gz	Cryo-EM structure of the human alpha 1 beta 3 gamma 2 GABAAreceptor in a lipid bilayer.
14	PDB:4hfcA	0.480	0.752	2.401E-19	311	0.114	0.183	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7kuyE	0.477	0.681	6.850E-18	338	0.124	0.183	7kuyE.pdb.gz	Characterization of the subunit composition and structure of adult human glycine receptors
16	PDB:2w8gC	0.374	0.830	7.237E-18	217	0.096	0.221	2w8gC.pdb.gz	Use of Acetylcholine Binding Protein in the Search for Novel Alpha7 Nicotinic Receptor Ligands. In Silico Docking, Pharmacological Screening, and X- Ray Analysis.
17	PDB:4afhA	0.373	0.837	4.435E-17	213	0.112	0.263	4afhA.pdb.gz	Molecular Actions of Smoking Cessation Drugs at Alpha4Beta2 Nicotinic Receptors Defined in Crystal Structures of a Homologous Binding Protein.
18	PDB:7l6qA	0.430	0.663	9.755E-13	311	0.096	0.154	7l6qA.pdb.gz	Structure and function at the lipid-protein interface of a pentameric ligand-gated ion channel.
19	PDB:6zgdA	0.406	0.683	1.440E-11	288	0.112	0.194	6zgdA.pdb.gz
20	PDB:5nzuD	0.076	0.085	2.321E-3	427	0.056	0.066	5nzuD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4ISQ3	0.0	634	525	0.683	0.653	A0A0R4ISQ3_DANRE Cholinergic receptor, nicotinic, beta 4 (neuronal) OS=Danio rerio OX=7955 GN=chrnb4 PE=3 SV=1
2	P09484	0.0	803	491	0.833	0.851	ACHB2_CHICK Neuronal acetylcholine receptor subunit beta-2 OS=Gallus gallus OX=9031 GN=CHRNB2 PE=1 SV=1
3	P12390	0.0	906	500	0.928	0.932	ACHB2_RAT Neuronal acetylcholine receptor subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Chrnb2 PE=1 SV=2
4	P12392	0.0	594	495	0.604	0.612	ACHB4_RAT Neuronal acetylcholine receptor subunit beta-4 OS=Rattus norvegicus OX=10116 GN=Chrnb4 PE=1 SV=1
5	P17787	0.0	1041	502	1.000	1.000	ACHB2_HUMAN Neuronal acetylcholine receptor subunit beta-2 OS=Homo sapiens OX=9606 GN=CHRNB2 PE=1 SV=1
6	P26153	0.0	669	470	0.661	0.706	ACHB4_CHICK Neuronal acetylcholine receptor subunit beta-4 (Fragment) OS=Gallus gallus OX=9031 GN=CHRNB4 PE=1 SV=1
7	P30926	0.0	613	498	0.627	0.633	ACHB4_HUMAN Neuronal acetylcholine receptor subunit beta-4 OS=Homo sapiens OX=9606 GN=CHRNB4 PE=1 SV=2
8	Q8R493	0.0	596	495	0.608	0.616	ACHB4_MOUSE Neuronal acetylcholine receptor subunit beta-4 OS=Mus musculus OX=10090 GN=Chrnb4 PE=2 SV=1
9	Q9ERK7	0.0	914	501	0.940	0.942	ACHB2_MOUSE Neuronal acetylcholine receptor subunit beta-2 OS=Mus musculus OX=10090 GN=Chrnb2 PE=2 SV=2
10	P04757	2.00e-156	456	499	0.454	0.457	ACHA3_RAT Neuronal acetylcholine receptor subunit alpha-3 OS=Rattus norvegicus OX=10116 GN=Chrna3 PE=1 SV=1
11	Q8R4G9	2.55e-156	456	499	0.454	0.457	ACHA3_MOUSE Neuronal acetylcholine receptor subunit alpha-3 OS=Mus musculus OX=10090 GN=Chrna3 PE=2 SV=1
12	Q9R0W9	6.12e-156	454	494	0.440	0.447	ACHA6_MOUSE Neuronal acetylcholine receptor subunit alpha-6 OS=Mus musculus OX=10090 GN=Chrna6 PE=2 SV=2
13	P09481	7.81e-155	452	496	0.450	0.456	ACHA3_CHICK Neuronal acetylcholine receptor subunit alpha-3 OS=Gallus gallus OX=9031 GN=CHRNA3 PE=1 SV=2
14	P43143	2.07e-154	451	493	0.436	0.444	ACHA6_RAT Neuronal acetylcholine receptor subunit alpha-6 OS=Rattus norvegicus OX=10116 GN=Chrna6 PE=2 SV=1
15	Q1RLX8	6.29e-154	450	520	0.486	0.469	Q1RLX8_DANRE Cholinergic receptor, nicotinic, alpha 2a (neuronal) OS=Danio rerio OX=7955 GN=zgc:136717 PE=2 SV=1
16	P32297	2.16e-153	448	505	0.446	0.444	ACHA3_HUMAN Neuronal acetylcholine receptor subunit alpha-3 OS=Homo sapiens OX=9606 GN=CHRNA3 PE=1 SV=4
17	A0A0X1KG79	2.90e-153	448	507	0.480	0.475	A0A0X1KG79_HUMAN Cholinergic receptor nicotinic alpha 2 subunit OS=Homo sapiens OX=9606 GN=CHRNA2 PE=3 SV=1
18	Q15822	6.23e-153	448	529	0.480	0.456	ACHA2_HUMAN Neuronal acetylcholine receptor subunit alpha-2 OS=Homo sapiens OX=9606 GN=CHRNA2 PE=1 SV=2
19	Q15825	1.54e-151	443	494	0.444	0.451	ACHA6_HUMAN Neuronal acetylcholine receptor subunit alpha-6 OS=Homo sapiens OX=9606 GN=CHRNA6 PE=1 SV=1
20	Q91X60	7.33e-151	442	512	0.470	0.461	ACHA2_MOUSE Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10329 DUF2417	2.5e+02	12.5	Region of unknown function (DUF2417)
2	PF02931 Neur_chan_LBD	8.9e-70	246.0	Neurotransmitter-gated ion-channel ligand binding domain
3	PF02932 Neur_chan_memb	9.9e-83	289.4	Neurotransmitter-gated ion-channel transmembrane region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359285	0.983	Neuronal acetylcholine receptor subunit alpha-4
2	9606.ENSP00000315602	0.944	Neuronal acetylcholine receptor subunit alpha-3
3	9606.ENSP00000407546	0.942	Neuronal acetylcholine receptor subunit alpha-7
4	9606.ENSP00000385026	0.941	Neuronal acetylcholine receptor subunit alpha-2
5	9606.ENSP00000261751	0.918	Neuronal acetylcholine receptor subunit beta-4
6	9606.ENSP00000312663	0.911	Neuronal acetylcholine receptor subunit alpha-9
7	9606.ENSP00000299565	0.890	Neuronal acetylcholine receptor subunit alpha-5
8	9606.ENSP00000371067	0.807	Tyrosine-protein kinase JAK2
9	9606.ENSP00000304290	0.738	Acetylcholine receptor subunit beta
10	9606.ENSP00000299847	0.725	CHRNA7-FAM7A fusion protein
11	9606.ENSP00000360822	0.704	Potassium channel subfamily T member 1
12	9606.ENSP00000455711	0.667	Transcriptional repressor scratch 1
13	9606.ENSP00000246515	0.662	Secreted Ly-6/uPAR-related protein 1
14	9606.ENSP00000293780	0.636	Acetylcholine receptor subunit epsilon
15	9606.ENSP00000263160	0.635	Vesicular glutamate transporter 2
16	9606.ENSP00000374145	0.635	Acetylcholine receptor subunit gamma
17	9606.ENSP00000258385	0.625	Acetylcholine receptor subunit delta
18	9606.ENSP00000261007	0.623	Acetylcholine receptor subunit alpha
19	9606.ENSP00000429562	0.616	Protein unc-13 homolog A
20	9606.ENSP00000276410	0.614	Neuronal acetylcholine receptor subunit alpha-6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022848	1.000	acetylcholine-gated monoatomic cation-selective channel activity
GO:0005515	0.999	protein binding
GO:0050997	0.997	quaternary ammonium group binding
GO:0042165	0.996	neurotransmitter binding
GO:0004888	0.989	transmembrane signaling receptor activity
GO:0043169	0.926	cation binding
GO:0015464	0.906	acetylcholine receptor activity
GO:0042166	0.808	acetylcholine binding
GO:0015318	0.591	inorganic molecular entity transmembrane transporter activity
GO:1901702	0.497	salt transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.990	cellular process
GO:0051899	0.990	membrane depolarization
GO:0050896	0.985	response to stimulus
GO:0050789	0.976	regulation of biological process
GO:0007154	0.939	cell communication
GO:0023052	0.937	signaling
GO:0050794	0.921	regulation of cellular process
GO:0042221	0.917	response to chemical
GO:0051716	0.845	cellular response to stimulus
GO:0035094	0.818	response to nicotine
GO:0032501	0.732	multicellular organismal process
GO:0099536	0.722	synaptic signaling
GO:0006810	0.559	transport
GO:0007165	0.487	signal transduction
GO:0007268	0.456	chemical synaptic transmission
GO:0003008	0.333	system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098797	0.999	plasma membrane protein complex
GO:0034702	0.996	ion channel complex
GO:0098802	0.993	plasma membrane signaling receptor complex
GO:0005892	0.972	acetylcholine-gated channel complex
GO:0043226	0.728	organelle
GO:0005622	0.621	intracellular anatomical structure
GO:0030054	0.437	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]