StarFunc result for job id P17812

User Input

>input (591 residues)
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFV
LDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDA
IQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHV
SLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQ
VICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCS
IALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQK
LCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN
STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRH
RFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPY
FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A2R8QCI7	0.971	0.941	0.000	610	0.861	0.834	A0A2R8QCI7.pdb.gz
2	AFDB:P17812	1.000	1.000	0.000	591	1.000	1.000	P17812.pdb.gz	PYRG1_HUMAN CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2
3	AFDB:Q6PEI7	0.964	0.964	0.000	591	0.866	0.866	Q6PEI7.pdb.gz	PYRG1_DANRE CTP synthase 1 OS=Danio rerio OX=7955 GN=ctps1 PE=1 SV=1
4	AFDB:P70303	0.952	0.960	4.579E-100	586	0.736	0.742	P70303.pdb.gz	PYRG2_MOUSE CTP synthase 2 OS=Mus musculus OX=10090 GN=Ctps2 PE=1 SV=1
5	AFDB:A0A2R8Q6Q1	0.926	0.965	3.016E-99	567	0.807	0.841	A0A2R8Q6Q1.pdb.gz
6	PDB:5u03A	0.920	0.971	8.360E-96	559	0.946	1.000	5u03A.pdb.gz	Human CTP synthase filament structure reveals the active enzyme conformation.
7	AFDB:Q9VUL1	0.953	0.898	1.717E-93	627	0.655	0.617	Q9VUL1.pdb.gz	PYRG_DROME CTP synthase OS=Drosophila melanogaster OX=7227 GN=Ctps PE=1 SV=2
8	AFDB:P28274	0.925	0.944	3.911E-87	579	0.560	0.572	P28274.pdb.gz	URA7_YEAST CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA7 PE=1 SV=2
9	AFDB:Q9LTW8	0.944	0.944	6.442E-87	591	0.569	0.569	Q9LTW8.pdb.gz	Q9LTW8_ARATH CTP synthase OS=Arabidopsis thaliana OX=3702 GN=EMB2742 PE=1 SV=1
10	AFDB:F4I6G9	0.934	0.920	1.122E-86	600	0.558	0.550	F4I6G9.pdb.gz	F4I6G9_ARATH CTP synthase OS=Arabidopsis thaliana OX=3702 GN=CTPS1 PE=1 SV=1
11	AFDB:O42644	0.930	0.916	3.400E-86	600	0.574	0.565	O42644.pdb.gz	PYRG_SCHPO CTP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ura7 PE=3 SV=1
12	PDB:6pk4A	0.932	0.984	1.434E-85	559	0.724	0.766	6pk4A.pdb.gz	Coupled structural transitions enable highly cooperative regulation of human CTPS2 filaments.
13	PDB:7miiA	0.833	0.990	2.090E-77	497	0.663	0.789	7miiA.pdb.gz	Structural basis for isoform-specific inhibition of human CTPS1.
14	PDB:7rmcV	0.898	0.946	7.058E-75	561	0.543	0.572	7rmcV.pdb.gz	Cryo-EM structures of CTP synthase filaments reveal mechanism of pH-sensitive assembly during budding yeast starvation.
15	PDB:6l6zA	0.903	0.948	5.492E-74	562	0.643	0.676	6l6zA.pdb.gz
16	PDB:2ad5B	0.855	0.941	3.869E-62	536	0.404	0.446	2ad5B.pdb.gz	Mechanisms of Product Feedback Regulation and Drug Resistance in Cytidine Triphosphate Synthetases from the Structure of a CTP-Inhibited Complex(,).
17	PDB:4zdjA	0.845	0.930	6.029E-62	535	0.425	0.469	4zdjA.pdb.gz	Thiophenecarboxamide Derivatives Activated by EthA Kill Mycobacterium tuberculosis by Inhibiting the CTP Synthetase PyrG.
18	PDB:6vtvB	0.277	0.611	8.003E-9	252	0.073	0.171	6vtvB.pdb.gz	PuuD gamma-glutamyl-gamma-aminobutyrate hydrolase
19	PDB:1jdbF	0.247	0.367	9.179E-8	380	0.098	0.153	1jdbF.pdb.gz	The structure of carbamoyl phosphate synthetase determined to 2.1 A resolution.
20	PDB:7d50B	0.269	0.576	1.995E-7	255	0.083	0.192	7d50B.pdb.gz	Structure and mechanism of the gamma-glutamyl-gamma-aminobutyrate hydrolase SpuA from Pseudomonas aeruginosa.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A9JT21	0.0	1076	589	0.861	0.864	A9JT21_DANRE CTP synthase OS=Danio rerio OX=7955 GN=LOC100005970 PE=1 SV=1
2	F4I6G9	0.0	680	600	0.563	0.555	F4I6G9_ARATH CTP synthase OS=Arabidopsis thaliana OX=3702 GN=CTPS1 PE=1 SV=1
3	G0HV10	0.0	540	553	0.482	0.515	PYRG_HALHT CTP synthase OS=Haloarcula hispanica (strain ATCC 33960 / DSM 4426 / JCM 8911 / NBRC 102182 / NCIMB 2187 / VKM B-1755) OX=634497 GN=pyrG PE=3 SV=2
4	O42644	0.0	686	600	0.570	0.562	PYRG_SCHPO CTP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ura7 PE=3 SV=1
5	O64753	0.0	653	597	0.538	0.533	O64753_ARATH CTP synthase OS=Arabidopsis thaliana OX=3702 GN=CTPS5 PE=1 SV=1
6	P17812	0.0	1224	591	1.000	1.000	PYRG1_HUMAN CTP synthase 1 OS=Homo sapiens OX=9606 GN=CTPS1 PE=1 SV=2
7	P28274	0.0	684	579	0.563	0.575	URA7_YEAST CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA7 PE=1 SV=2
8	P38627	0.0	664	578	0.548	0.561	URA8_YEAST CTP synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=URA8 PE=1 SV=4
9	P70303	0.0	925	586	0.736	0.742	PYRG2_MOUSE CTP synthase 2 OS=Mus musculus OX=10090 GN=Ctps2 PE=1 SV=1
10	Q0WRY1	0.0	658	597	0.550	0.544	Q0WRY1_ARATH CTP synthase OS=Arabidopsis thaliana OX=3702 GN=CTPS4 PE=1 SV=1
11	Q6PEI7	0.0	1082	591	0.866	0.866	PYRG1_DANRE CTP synthase 1 OS=Danio rerio OX=7955 GN=ctps1 PE=1 SV=1
12	Q8L6Z9	0.0	680	556	0.552	0.586	Q8L6Z9_ARATH CTP synthase OS=Arabidopsis thaliana OX=3702 GN=CTPS3 PE=1 SV=1
13	Q9LTW8	0.0	679	591	0.567	0.567	Q9LTW8_ARATH CTP synthase OS=Arabidopsis thaliana OX=3702 GN=EMB2742 PE=1 SV=1
14	Q9NRF8	0.0	938	586	0.743	0.749	PYRG2_HUMAN CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1
15	Q9VUL1	0.0	822	627	0.660	0.622	PYRG_DROME CTP synthase OS=Drosophila melanogaster OX=7227 GN=Ctps PE=1 SV=2
16	X2JCY2	0.0	822	627	0.660	0.622	X2JCY2_DROME CTP synthase OS=Drosophila melanogaster OX=7227 GN=Ctps PE=3 SV=1
17	P13242	3.25e-173	503	535	0.425	0.469	PYRG_BACSU CTP synthase OS=Bacillus subtilis (strain 168) OX=224308 GN=pyrG PE=1 SV=1
18	Q4GZ95	1.49e-165	486	589	0.430	0.431	Q4GZ95_TRYB2 CTP synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.1240 PE=1 SV=1
19	P9WHK7	2.30e-160	473	586	0.421	0.425	PYRG_MYCTU CTP synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pyrG PE=1 SV=1
20	P0A7E5	1.55e-156	461	545	0.413	0.448	PYRG_ECOLI CTP synthase OS=Escherichia coli (strain K12) OX=83333 GN=pyrG PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01656 CbiA	1e+02	14.3	CobQ/CobB/MinD/ParA nucleotide binding domain
2	PF06418 CTP_synth_N	3.6e-126	431.5	CTP synthase N-terminus
3	PF00117 GATase	1.6e-49	179.8	Glutamine amidotransferase class-I
4	PF07722 Peptidase_C26	6.1e-05	34.4	Peptidase C26
5	PF02779 Transket_pyr	1.1e+02	13.8	Transketolase, pyrimidine binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361704

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419851	0.987	GMP synthase [glutamine-hydrolyzing]
2	9606.ENSP00000321584	0.972	Inosine-5'-monophosphate dehydrogenase 2
3	9606.ENSP00000401264	0.949	CTP synthase 2
4	9606.ENSP00000345096	0.942	Inosine-5'-monophosphate dehydrogenase 1
5	9606.ENSP00000337060	0.937	Nucleoside diphosphate kinase A
6	9606.ENSP00000360561	0.934	Ectonucleoside triphosphate diphosphohydrolase 8
7	9606.ENSP00000416658	0.933	Nucleoside diphosphate kinase 6
8	9606.ENSP00000219479	0.922	Nucleoside diphosphate kinase, mitochondrial
9	9606.ENSP00000360250	0.922	Ectonucleoside triphosphate diphosphohydrolase 1
10	9606.ENSP00000356785	0.919	Nucleoside diphosphate kinase 7
11	9606.ENSP00000301825	0.914	Ectonucleoside triphosphate diphosphohydrolase 3
12	9606.ENSP00000219302	0.912	Nucleoside diphosphate kinase 3
13	9606.ENSP00000265191	0.912	Nucleoside diphosphate kinase homolog 5
14	9606.ENSP00000368455	0.907	Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]
15	9606.ENSP00000354238	0.901	Ectonucleotide pyrophosphatase/phosphodiesterase family member 1
16	9606.ENSP00000406261	0.901	Ectonucleotide pyrophosphatase/phosphodiesterase family member 3
17	9606.ENSP00000307674	0.900	Soluble calcium-activated nucleotidase 1
18	9606.ENSP00000355587	0.900	Cancer-related nucleoside-triphosphatase
19	9606.ENSP00000444136	0.900	DNA-directed RNA polymerase I subunit RPA2
20	9606.ENSP00000466967	0.876	tRNA (guanine(26)-N(2))-dimethyltransferase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003883	1.000	CTP synthase activity
GO:0005515	0.996	protein binding
GO:0042802	0.993	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.965	organic substance metabolic process
GO:0044237	0.963	cellular metabolic process
GO:0044238	0.962	primary metabolic process
GO:0006807	0.949	nitrogen compound metabolic process
GO:0034641	0.893	cellular nitrogen compound metabolic process
GO:0055086	0.831	nucleobase-containing small molecule metabolic process
GO:1901564	0.824	organonitrogen compound metabolic process
GO:0019637	0.796	organophosphate metabolic process
GO:0006753	0.776	nucleoside phosphate metabolic process
GO:0009117	0.754	nucleotide metabolic process
GO:0032501	0.750	multicellular organismal process
GO:1901576	0.727	organic substance biosynthetic process
GO:0044249	0.727	cellular biosynthetic process
GO:0072527	0.709	pyrimidine-containing compound metabolic process
GO:0044271	0.697	cellular nitrogen compound biosynthetic process
GO:0006220	0.645	pyrimidine nucleotide metabolic process
GO:1901135	0.630	carbohydrate derivative metabolic process
GO:1901566	0.615	organonitrogen compound biosynthetic process
GO:0034654	0.613	nucleobase-containing compound biosynthetic process
GO:1901293	0.540	nucleoside phosphate biosynthetic process
GO:0009141	0.531	nucleoside triphosphate metabolic process
GO:0019693	0.413	ribose phosphate metabolic process
GO:0032502	0.373	developmental process
GO:0009199	0.371	ribonucleoside triphosphate metabolic process
GO:0009165	0.323	nucleotide biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0016020	0.991	membrane
GO:0099512	0.965	supramolecular fiber
GO:0043231	0.838	intracellular membrane-bounded organelle
GO:0031981	0.505	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:26426	1.000	ATP + H2O + L-glutamine + UTP = ADP + CTP + 2 H(+) + L-glutamate + phosphate
EC:6.3.4.2	1.000	CTP synthase (glutamine hydrolyzing).

[back to server]