StarFunc result for job id P17813

User Input

>input (658 residues)
MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNA
ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAY
NSSLVTFQEPPGVNTTELPSFPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLS
FCMLEASQDMGRTLEWRPRTPALVRGCHLEGVAGHKEAHILRVLPGHSAGPRTVTVKVEL
SCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTPQGLL
GEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTCSPELLMSLIQ
TKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM
ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVS
PSVSEFLLQLDSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVP
IPKTGTLSCTVALRPKTGSQDQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAF
LIGALLTAALWYIYSHTRSPSKREPVVAVAAPASSESSSTNHSIGSTQSTPCSTSSMA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R878	0.491	0.491	0.000	658	1.000	1.000	A0A024R878.pdb.gz
2	AFDB:Q63961	0.472	0.476	4.396E-95	653	0.714	0.720	Q63961.pdb.gz	EGLN_MOUSE Endoglin OS=Mus musculus OX=10090 GN=Eng PE=1 SV=2
3	AFDB:Q3KR75	0.460	0.433	2.271E-92	699	0.723	0.681	Q3KR75.pdb.gz	Q3KR75_RAT Eng protein OS=Rattus norvegicus OX=10116 GN=Eng PE=2 SV=1
4	AFDB:P37176	0.455	0.458	7.432E-88	653	0.695	0.700	P37176.pdb.gz	EGLN_PIG Endoglin OS=Sus scrofa OX=9823 GN=ENG PE=1 SV=1
5	AFDB:Q6B0K7	0.382	0.390	4.631E-53	644	0.345	0.352	Q6B0K7.pdb.gz	Q6B0K7_CHICK Endoglin OS=Gallus gallus OX=9031 PE=2 SV=1
6	PDB:5hzwA	0.451	0.444	2.130E-52	668	0.459	0.452	5hzwA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
7	AFDB:Q03167	0.307	0.250	6.985E-42	851	0.284	0.220	Q03167.pdb.gz	TGBR3_HUMAN Transforming growth factor beta receptor type 3 OS=Homo sapiens OX=9606 GN=TGFBR3 PE=1 SV=3
8	AFDB:P35054	0.312	0.254	1.717E-41	848	0.286	0.222	P35054.pdb.gz	TGBR3_PIG Transforming growth factor beta receptor type 3 OS=Sus scrofa OX=9823 GN=TGFBR3 PE=2 SV=1
9	AFDB:Q90998	0.313	0.256	3.457E-41	841	0.257	0.201	Q90998.pdb.gz	Q90998_CHICK Transforming growth factor beta receptor 3 OS=Gallus gallus OX=9031 GN=TGFBR3 PE=1 SV=1
10	AFDB:P26342	0.305	0.248	1.143E-39	853	0.283	0.218	P26342.pdb.gz	TGBR3_RAT Transforming growth factor beta receptor type 3 OS=Rattus norvegicus OX=10116 GN=Tgfbr3 PE=1 SV=1
11	AFDB:A0A0H3UK16	0.318	0.257	2.544E-39	848	0.257	0.199	A0A0H3UK16.pdb.gz	A0A0H3UK16_DANRE Transforming growth factor beta receptor III OS=Danio rerio OX=7955 GN=si:ch73-18k18.1 PE=2 SV=1
12	PDB:5hzvA	0.290	0.317	1.162E-36	598	0.347	0.381	5hzvA.pdb.gz	Structural Basis of the Human Endoglin-BMP9 Interaction: Insights into BMP Signaling and HHT1.
13	PDB:4wrnB	0.165	0.164	8.651E-10	663	0.061	0.060	4wrnB.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
14	PDB:4wrnA	0.171	0.162	1.228E-9	693	0.058	0.055	4wrnA.pdb.gz	A structured interdomain linker directs self-polymerization of human uromodulin.
15	PDB:3apnA	0.139	0.157	7.665E-4	563	0.041	0.048	3apnA.pdb.gz
16	PDB:7d56C	0.145	0.148	9.841E-4	640	0.036	0.037	7d56C.pdb.gz	Structures of human peptidylarginine deiminase type III provide insights into substrate recognition and inhibitor design.
17	PDB:4x8gA	0.113	0.120	1.468E-3	606	0.038	0.041	4x8gA.pdb.gz	Inhibition of PAD4 activity is sufficient to disrupt mouse and human NET formation.
18	PDB:7d4yB	0.126	0.135	1.543E-3	601	0.033	0.037	7d4yB.pdb.gz
19	PDB:7sqcO1	0.089	0.088	1.705E-3	673	0.043	0.042	7sqcO1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
20	PDB:3oaiA	0.124	0.162	2.083E-3	488	0.030	0.041	3oaiA.pdb.gz	Crystal structure of the extracellular domain of human myelin protein zero.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A8I6A813	0.0	871	635	0.702	0.728	A0A8I6A813_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=1 SV=1
2	A0A8I6GL08	0.0	882	639	0.708	0.729	A0A8I6GL08_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=1 SV=1
3	F5GX88	0.0	975	476	0.723	1.000	F5GX88_HUMAN Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=1
4	M0RA19	0.0	853	622	0.666	0.704	M0RA19_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=1 SV=3
5	P17813	0.0	1339	658	1.000	1.000	EGLN_HUMAN Endoglin OS=Homo sapiens OX=9606 GN=ENG PE=1 SV=2
6	P37176	0.0	865	653	0.699	0.704	EGLN_PIG Endoglin OS=Sus scrofa OX=9823 GN=ENG PE=1 SV=1
7	Q3KR75	0.0	876	699	0.725	0.682	Q3KR75_RAT Eng protein OS=Rattus norvegicus OX=10116 GN=Eng PE=2 SV=1
8	Q5T9B9	0.0	1261	625	0.939	0.989	Q5T9B9_HUMAN Endoglin (Osler-Rendu-Weber syndrome 1) OS=Homo sapiens OX=9606 GN=ENG PE=4 SV=1
9	Q63961	0.0	897	653	0.716	0.721	EGLN_MOUSE Endoglin OS=Mus musculus OX=10090 GN=Eng PE=1 SV=2
10	Q6Q3E8	0.0	904	650	0.725	0.734	Q6Q3E8_RAT Endoglin OS=Rattus norvegicus OX=10116 GN=Eng PE=4 SV=1
11	Q6B0K7	2.34e-83	277	644	0.356	0.363	Q6B0K7_CHICK Endoglin OS=Gallus gallus OX=9031 PE=2 SV=1
12	P35054	1.60e-16	86.3	848	0.068	0.053	TGBR3_PIG Transforming growth factor beta receptor type 3 OS=Sus scrofa OX=9823 GN=TGFBR3 PE=2 SV=1
13	P26342	2.25e-16	85.5	853	0.068	0.053	TGBR3_RAT Transforming growth factor beta receptor type 3 OS=Rattus norvegicus OX=10116 GN=Tgfbr3 PE=1 SV=1
14	O88393	2.39e-16	85.5	850	0.068	0.053	TGBR3_MOUSE Transforming growth factor beta receptor type 3 OS=Mus musculus OX=10090 GN=Tgfbr3 PE=1 SV=1
15	Q03167	7.88e-16	84.0	851	0.068	0.053	TGBR3_HUMAN Transforming growth factor beta receptor type 3 OS=Homo sapiens OX=9606 GN=TGFBR3 PE=1 SV=3
16	Q90998	1.10e-14	80.1	841	0.065	0.051	Q90998_CHICK Transforming growth factor beta receptor 3 OS=Gallus gallus OX=9031 GN=TGFBR3 PE=1 SV=1
17	E7FDB6	2.83e-14	79.0	848	0.065	0.051	E7FDB6_DANRE Transforming growth factor, beta receptor III OS=Danio rerio OX=7955 GN=tgfbr3 PE=1 SV=1
18	A0A0H3UK16	2.95e-14	79.0	848	0.065	0.051	A0A0H3UK16_DANRE Transforming growth factor beta receptor III OS=Danio rerio OX=7955 GN=si:ch73-18k18.1 PE=2 SV=1
19	A0A1Z2R986	7.02e-10	64.3	559	0.073	0.086	EGLN_DANRE Endoglin OS=Danio rerio OX=7955 GN=eng PE=2 SV=1
20	P52304	4.2	33.1	576	0.032	0.036	POLO_DROME Serine/threonine-protein kinase polo OS=Drosophila melanogaster OX=7227 GN=polo PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00100 Zona_pellucida	0.0036	28.6	Zona pellucida-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362299

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000221930	0.999	Transforming growth factor beta-1
2	9606.ENSP00000238682	0.999	Transforming growth factor beta-3
3	9606.ENSP00000364133	0.999	TGF-beta receptor type-1
4	9606.ENSP00000463051	0.999	Growth/differentiation factor 2
5	9606.ENSP00000373574	0.998	Serine/threonine-protein kinase receptor R3
6	9606.ENSP00000351905	0.996	TGF-beta receptor type-2
7	9606.ENSP00000363708	0.977	Bone morphogenetic protein receptor type-2
8	9606.ENSP00000241416	0.967	Activin receptor type-2A
9	9606.ENSP00000403701	0.966	Beta-arrestin-2
10	9606.ENSP00000302621	0.964	Leucine rich alpha-2-glycoprotein 1
11	9606.ENSP00000441954	0.960	Mothers against decapentaplegic homolog 5
12	9606.ENSP00000369154	0.959	Mothers against decapentaplegic homolog 9
13	9606.ENSP00000340361	0.956	Activin receptor type-2B
14	9606.ENSP00000426568	0.947	Mothers against decapentaplegic homolog 1
15	9606.ENSP00000262158	0.938	Mothers against decapentaplegic homolog 7
16	9606.ENSP00000339191	0.936	Caveolin-1
17	9606.ENSP00000263025	0.931	Mitogen-activated protein kinase 3
18	9606.ENSP00000242208	0.927	Inhibin beta A chain
19	9606.ENSP00000257770	0.926	5'-nucleotidase
20	9606.ENSP00000284240	0.922	Thy-1 membrane glycoprotein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005160	0.999	transforming growth factor beta receptor binding
GO:0097367	0.997	carbohydrate derivative binding
GO:0005114	0.983	type II transforming growth factor beta receptor binding
GO:0005539	0.879	glycosaminoglycan binding
GO:0019838	0.677	growth factor binding
GO:0019955	0.671	cytokine binding
GO:0050431	0.468	transforming growth factor beta binding
GO:0042802	0.459	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0048522	0.991	positive regulation of cellular process
GO:0007154	0.989	cell communication
GO:0071559	0.989	response to transforming growth factor beta
GO:0060255	0.989	regulation of macromolecule metabolic process
GO:0023052	0.988	signaling
GO:0048856	0.986	anatomical structure development
GO:0048583	0.985	regulation of response to stimulus
GO:0080090	0.983	regulation of primary metabolic process
GO:0051171	0.982	regulation of nitrogen compound metabolic process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0007165	0.978	signal transduction
GO:0042327	0.975	positive regulation of phosphorylation
GO:0001934	0.973	positive regulation of protein phosphorylation
GO:0016043	0.966	cellular component organization
GO:0007167	0.961	enzyme-linked receptor protein signaling pathway
GO:0071363	0.958	cellular response to growth factor stimulus
GO:0010468	0.958	regulation of gene expression
GO:0009966	0.955	regulation of signal transduction
GO:0042221	0.954	response to chemical
GO:0007178	0.953	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0009891	0.951	positive regulation of biosynthetic process
GO:0007275	0.947	multicellular organism development
GO:0090092	0.943	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010628	0.942	positive regulation of gene expression
GO:0010712	0.938	regulation of collagen metabolic process
GO:0071560	0.937	cellular response to transforming growth factor beta stimulus
GO:0007179	0.934	transforming growth factor beta receptor signaling pathway
GO:0048731	0.933	system development
GO:0090287	0.932	regulation of cellular response to growth factor stimulus
GO:1903844	0.923	regulation of cellular response to transforming growth factor beta stimulus
GO:0045229	0.917	external encapsulating structure organization
GO:0043062	0.917	extracellular structure organization
GO:0009605	0.914	response to external stimulus
GO:0017015	0.912	regulation of transforming growth factor beta receptor signaling pathway
GO:0048513	0.910	animal organ development
GO:0010033	0.905	response to organic substance
GO:0050678	0.904	regulation of epithelial cell proliferation
GO:0032965	0.864	regulation of collagen biosynthetic process
GO:0010714	0.862	positive regulation of collagen metabolic process
GO:0001936	0.842	regulation of endothelial cell proliferation
GO:0048523	0.811	negative regulation of cellular process
GO:0051179	0.809	localization
GO:0032967	0.809	positive regulation of collagen biosynthetic process
GO:0030198	0.808	extracellular matrix organization
GO:0050793	0.769	regulation of developmental process
GO:0051239	0.763	regulation of multicellular organismal process
GO:0009628	0.758	response to abiotic stimulus
GO:0008284	0.755	positive regulation of cell population proliferation
GO:0051234	0.750	establishment of localization
GO:0009612	0.729	response to mechanical stimulus
GO:0048584	0.728	positive regulation of response to stimulus
GO:0006810	0.724	transport
GO:0006355	0.720	regulation of DNA-templated transcription
GO:0030154	0.709	cell differentiation
GO:0046903	0.704	secretion
GO:0072359	0.702	circulatory system development
GO:0009653	0.700	anatomical structure morphogenesis
GO:0048545	0.690	response to steroid hormone
GO:0010557	0.684	positive regulation of macromolecule biosynthetic process
GO:0051240	0.683	positive regulation of multicellular organismal process
GO:0031328	0.681	positive regulation of cellular biosynthetic process
GO:0009967	0.669	positive regulation of signal transduction
GO:0009888	0.667	tissue development
GO:0060348	0.658	bone development
GO:0071260	0.645	cellular response to mechanical stimulus
GO:0031960	0.640	response to corticosteroid
GO:0045935	0.545	positive regulation of nucleobase-containing compound metabolic process
GO:0009410	0.535	response to xenobiotic stimulus
GO:0030334	0.504	regulation of cell migration
GO:0045595	0.461	regulation of cell differentiation
GO:0065009	0.458	regulation of molecular function
GO:0051254	0.451	positive regulation of RNA metabolic process
GO:0006950	0.407	response to stress
GO:0009887	0.348	animal organ morphogenesis
GO:0051094	0.344	positive regulation of developmental process
GO:0007507	0.342	heart development
GO:1902680	0.328	positive regulation of RNA biosynthetic process
GO:0070887	0.318	cellular response to chemical stimulus
GO:0045893	0.312	positive regulation of DNA-templated transcription
GO:0140352	0.303	export from cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005886	0.997	plasma membrane
GO:0005654	0.991	nucleoplasm
GO:0005576	0.964	extracellular region
GO:0016604	0.822	nuclear body
GO:0005615	0.778	extracellular space
GO:0005737	0.755	cytoplasm
GO:0009986	0.545	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]