StarFunc result for job id P17858

User Input

>input (780 residues)
MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKQANWLSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDG
SLTGANIFRSEWGSLLEELVAEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLMECVQMTKEVQK
AMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESI
VENIRIYGIHALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKVNVEHMTEKMKTDIQRGLVLRNEKCHDYYTTEFLYNLYSSEGKGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVFANAPDSACVIGLKKKAVAFS
PVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVTRRTLSMDKGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7lw1A	0.945	0.991	0.000	744	0.951	0.997	7lw1A.pdb.gz	Selective activation of PFKL suppresses the phagocytic oxidative burst.
2	AFDB:A0A060WI24	0.975	0.975	0.000	780	0.656	0.656	A0A060WI24.pdb.gz	A0A060WI24_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075887001 PE=3 SV=1
3	AFDB:A0A060X7Z0	0.976	0.939	0.000	811	0.668	0.642	A0A060X7Z0.pdb.gz	A0A060X7Z0_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028237001 PE=3 SV=1
4	AFDB:P00511	0.984	0.984	0.000	780	0.683	0.683	P00511.pdb.gz	PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus OX=9986 GN=PFKM PE=1 SV=3
5	AFDB:P12382	0.997	0.997	0.000	780	0.942	0.942	P12382.pdb.gz	PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus OX=10090 GN=Pfkl PE=1 SV=4
6	AFDB:P47859	0.960	0.947	0.000	791	0.672	0.662	P47859.pdb.gz	PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus OX=9986 GN=PFKP PE=1 SV=1
7	AFDB:P47860	0.965	0.956	0.000	788	0.668	0.661	P47860.pdb.gz	PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=2
8	AFDB:Q8AYP9	0.984	0.996	0.000	770	0.855	0.866	Q8AYP9.pdb.gz	Q8AYP9_CHICK ATP-dependent 6-phosphofructokinase OS=Gallus gallus OX=9031 GN=pfk PE=2 SV=1
9	AFDB:Q90YA3	0.963	0.977	0.000	769	0.673	0.683	Q90YA3.pdb.gz	Q90YA3_CHICK ATP-dependent 6-phosphofructokinase OS=Gallus gallus OX=9031 GN=pfk PE=2 SV=1
10	PDB:4xyjA	0.941	0.956	4.582E-102	768	0.676	0.686	4xyjA.pdb.gz	Structures of human phosphofructokinase-1 and atomic basis of cancer-associated mutations.
11	AFDB:P52034	0.967	0.958	2.586E-101	788	0.555	0.549	P52034.pdb.gz	PFKA_DROME ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster OX=7227 GN=Pfk PE=2 SV=2
12	PDB:3o8lA	0.937	0.976	1.452E-98	748	0.676	0.705	3o8lA.pdb.gz	The Crystal Structures of Eukaryotic Phosphofructokinases from Baker's Yeast and Rabbit Skeletal Muscle.
13	AFDB:O42938	0.923	0.765	2.276E-86	942	0.442	0.366	O42938.pdb.gz	PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfk1 PE=1 SV=1
14	PDB:4a3sA	0.372	0.894	3.805E-27	319	0.183	0.448	4a3sA.pdb.gz
15	PDB:1pfkA	0.368	0.878	1.505E-25	320	0.165	0.403	1pfkA.pdb.gz	Crystal structure of the complex of phosphofructokinase from Escherichia coli with its reaction products.
16	PDB:6qu3A	0.350	0.569	5.169E-20	464	0.117	0.196	6qu3A.pdb.gz	Fast acting allosteric phosphofructokinase inhibitors block trypanosome glycolysis and cure acute African trypanosomiasis in mice.
17	PDB:1kzhB	0.348	0.500	4.623E-14	530	0.099	0.145	1kzhB.pdb.gz	The structure of a pyrophosphate-dependent phosphofructokinase from the Lyme disease spirochete Borrelia burgdorferi.
18	PDB:2f48B	0.328	0.455	2.737E-12	552	0.108	0.152	2f48B.pdb.gz	Crystal Structure of A Novel Fructose 1,6-Bisphosphate and AlF3 containing Pyrophosphate-dependent Phosphofructo-1-kinase Complex from Borrelia burgdorferi
19	PDB:3hazA	0.139	0.118	2.832E-3	983	0.094	0.074	3hazA.pdb.gz	Crystal structure of the bifunctional proline utilization A flavoenzyme from Bradyrhizobium japonicum
20	PDB:4xc6A	0.111	0.091	3.643E-3	1067	0.119	0.087	4xc6A.pdb.gz	Visualization of a radical B12 enzyme with its G-protein chaperone.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A060WI24	1121	780	0.655	0.655	A0A060WI24_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00075887001 PE=3 SV=1
2	A0A060X7Z0	1115	811	0.669	0.644	A0A060X7Z0_ONCMY ATP-dependent 6-phosphofructokinase OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028237001 PE=3 SV=1
3	O14943	541	412	0.324	0.614	O14943_HUMAN Phosphofructokinase-P (Fragment) OS=Homo sapiens OX=9606 GN=PFK-P PE=2 SV=1
4	O42938	664	942	0.454	0.376	PFKA_SCHPO ATP-dependent 6-phosphofructokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pfk1 PE=1 SV=1
5	P00511	1143	780	0.683	0.683	PFKAM_RABIT ATP-dependent 6-phosphofructokinase, muscle type OS=Oryctolagus cuniculus OX=9986 GN=PFKM PE=1 SV=3
6	P08237	1147	780	0.686	0.686	PFKAM_HUMAN ATP-dependent 6-phosphofructokinase, muscle type OS=Homo sapiens OX=9606 GN=PFKM PE=1 SV=2
7	P12382	1531	780	0.942	0.942	PFKAL_MOUSE ATP-dependent 6-phosphofructokinase, liver type OS=Mus musculus OX=10090 GN=Pfkl PE=1 SV=4
8	P16861	598	987	0.421	0.332	PFKA1_YEAST ATP-dependent 6-phosphofructokinase subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK1 PE=1 SV=1
9	P16862	631	959	0.435	0.353	PFKA2_YEAST ATP-dependent 6-phosphofructokinase subunit beta OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PFK2 PE=1 SV=4
10	P17858	1615	780	1.000	1.000	PFKAL_HUMAN ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL PE=1 SV=6
11	P30835	1529	780	0.942	0.942	PFKAL_RAT ATP-dependent 6-phosphofructokinase, liver type OS=Rattus norvegicus OX=10116 GN=Pfkl PE=1 SV=3
12	P47857	1147	780	0.686	0.686	PFKAM_MOUSE ATP-dependent 6-phosphofructokinase, muscle type OS=Mus musculus OX=10090 GN=Pfkm PE=1 SV=3
13	P47858	1132	780	0.679	0.679	PFKAM_RAT ATP-dependent 6-phosphofructokinase, muscle type OS=Rattus norvegicus OX=10116 GN=Pfkm PE=1 SV=3
14	P47859	1107	791	0.677	0.668	PFKAP_RABIT ATP-dependent 6-phosphofructokinase, platelet type OS=Oryctolagus cuniculus OX=9986 GN=PFKP PE=1 SV=1
15	P47860	1095	788	0.665	0.659	PFKAP_RAT ATP-dependent 6-phosphofructokinase, platelet type OS=Rattus norvegicus OX=10116 GN=Pfkp PE=1 SV=2
16	P52034	900	788	0.546	0.541	PFKA_DROME ATP-dependent 6-phosphofructokinase OS=Drosophila melanogaster OX=7227 GN=Pfk PE=2 SV=2
17	P90521	661	834	0.421	0.393	PFKA_DICDI ATP-dependent 6-phosphofructokinase OS=Dictyostelium discoideum OX=44689 GN=pfkA PE=1 SV=2
18	Q01813	1117	784	0.676	0.672	PFKAP_HUMAN ATP-dependent 6-phosphofructokinase, platelet type OS=Homo sapiens OX=9606 GN=PFKP PE=1 SV=2
19	Q5AGZ8	621	946	0.422	0.348	Q5AGZ8_CANAL ATP-dependent 6-phosphofructokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFK2 PE=3 SV=1
20	Q5AK53	645	987	0.428	0.338	Q5AK53_CANAL ATP-dependent 6-phosphofructokinase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PFK1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00365 PFK	5.6e-197	664.2	Phosphofructokinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000269848

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000405573	0.992	Glucose-6-phosphate isomerase
2	9606.ENSP00000345771	0.987	ATP-dependent 6-phosphofructokinase, muscle type
3	9606.ENSP00000378669	0.977	Fructose-bisphosphate aldolase A
4	9606.ENSP00000226253	0.974	Belongs to the class I fructose-bisphosphate aldolase family
5	9606.ENSP00000363988	0.974	Belongs to the class I fructose-bisphosphate aldolase family
6	9606.ENSP00000370517	0.958	ATP-dependent 6-phosphofructokinase, platelet type
7	9606.ENSP00000321259	0.956	Transaldolase
8	9606.ENSP00000391481	0.950	Transketolase
9	9606.ENSP00000364486	0.948	Fructose-1,6-bisphosphatase isozyme 2
10	9606.ENSP00000451828	0.948	RAC-alpha serine/threonine-protein kinase
11	9606.ENSP00000408025	0.944	Fructose-1,6-bisphosphatase 1
12	9606.ENSP00000280605	0.943	Transketolase-like protein 2
13	9606.ENSP00000358931	0.930	Transketolase-like protein 1
14	9606.ENSP00000318318	0.927	Mannose-6-phosphate isomerase
15	9606.ENSP00000229270	0.926	Triosephosphate isomerase 1
16	9606.ENSP00000320171	0.919	Pyruvate kinase PKM
17	9606.ENSP00000292432	0.915	Catalyzes the phosphorylation of hexose, such as D-glucose and D-fructose, to hexose 6-phosphate (D-glucose 6-phosphate and D- fructose 6-phosphate, respectively) . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate .
18	9606.ENSP00000346643	0.914	Putative hexokinase HKDC1
19	9606.ENSP00000402103	0.911	Catalyzes the phosphorylation of various hexoses, such as D- glucose, D-glucosamine, D-fructose, D-mannose and 2-deoxy-D-glucose, to hexose 6-phosphate (D-glucose 6-phosphate, D-glucosamine 6-phosphate, D-fructose 6-phosphate, D-mannose 6-phosphate and 2-deoxy-D-glucose 6- phosphate, respectively) (PubMed:1637300, PubMed:25316723, PubMed:27374331). Does not phosphorylate N-acetyl-D-glucosamine . Mediates the initial step of glycolysis by catalyzing phosphorylation of D-glucose to D-glucose 6-phosphate (By similarity). Involved in innate immunity and inflammation by acting as a pattern [...]
20	9606.ENSP00000290573	0.905	Hexokinase-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003872	0.999	6-phosphofructokinase activity
GO:0005515	0.991	protein binding
GO:0097159	0.694	organic cyclic compound binding
GO:1901363	0.691	heterocyclic compound binding
GO:0042802	0.541	identical protein binding
GO:0043167	0.460	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006096	0.995	glycolytic process
GO:0050896	0.319	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.874	intracellular membrane-bounded organelle
GO:0005576	0.816	extracellular region
GO:0031982	0.804	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:16109	0.999	ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 1,6-bisphosphate + H(+)
EC:2.7.1.11	0.999	6-phosphofructokinase.

[back to server]