StarFunc result for job id P17861

User Input

>input (261 residues)
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQL
SPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP
YQPPFLCQWGRHQPSWKPLMN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17861	1.000	1.000	6.975E-38	261	1.000	1.000	P17861.pdb.gz	XBP1_HUMAN X-box-binding protein 1 OS=Homo sapiens OX=9606 GN=XBP1 PE=1 SV=2
2	AFDB:O35426	0.473	0.464	1.538E-24	267	0.808	0.790	O35426.pdb.gz	XBP1_MOUSE X-box-binding protein 1 OS=Mus musculus OX=10090 GN=Xbp1 PE=1 SV=2
3	AFDB:Q8UVQ5	0.433	0.430	5.286E-18	263	0.567	0.563	Q8UVQ5.pdb.gz
4	AFDB:A7MCI6	0.322	0.227	8.710E-9	383	0.421	0.287	A7MCI6.pdb.gz
5	AFDB:Q5BI44	0.281	0.241	3.843E-5	307	0.295	0.251	Q5BI44.pdb.gz	Q5BI44_DROME LD42070p OS=Drosophila melanogaster OX=7227 GN=Xbp1 PE=2 SV=1
6	AFDB:Q8MLW7	0.204	0.109	4.294E-3	498	0.257	0.135	Q8MLW7.pdb.gz	Q8MLW7_DROME X box binding protein-1, isoform E OS=Drosophila melanogaster OX=7227 GN=Xbp1 PE=4 SV=4
7	AFDB:F7BMG3	0.271	0.173	4.602E-3	437	0.211	0.126	F7BMG3.pdb.gz	F7BMG3_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=2
8	AFDB:P15336	0.285	0.155	2.994E-2	505	0.165	0.085	P15336.pdb.gz	ATF2_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=4
9	AFDB:Q388D2	0.192	0.140	3.951E-2	391	0.176	0.118	Q388D2.pdb.gz	Q388D2_TRYB2 SH3 domain protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.1950 PE=4 SV=1
10	AFDB:Q13033	0.168	0.069	9.081E-2	797	0.195	0.064	Q13033.pdb.gz	STRN3_HUMAN Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3 PE=1 SV=3
11	PDB:6govN	0.107	0.206	2.142	110	0.077	0.182	6govN.pdb.gz	Structural Basis for the Action of an All-Purpose Transcription Anti-termination Factor.
12	PDB:6rlbD	0.106	0.067	4.594	446	0.054	0.031	6rlbD.pdb.gz
13	PDB:7mq8SS	0.126	0.165	6.966	197	0.073	0.096	7mq8SS.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5xtcb	0.101	0.172	8.002	124	0.088	0.185	5xtcb.pdb.gz	Architecture of Human Mitochondrial Respiratory Megacomplex I2III2IV2.
15	PDB:7ajtCK	0.073	0.086	8.002	207	0.077	0.097	7ajtCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
16	PDB:6qlfQ	0.116	0.143	9.192	204	0.100	0.127	6qlfQ.pdb.gz
17	PDB:7mq8SY	0.123	0.133	9.192	238	0.054	0.059	7mq8SY.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17861	0.0	517	261	1.000	1.000	XBP1_HUMAN X-box-binding protein 1 OS=Homo sapiens OX=9606 GN=XBP1 PE=1 SV=2
2	Q9R1S4	1.45e-136	387	267	0.789	0.772	XBP1_RAT X-box-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Xbp1 PE=2 SV=1
3	O35426	5.00e-132	375	267	0.774	0.757	XBP1_MOUSE X-box-binding protein 1 OS=Mus musculus OX=10090 GN=Xbp1 PE=1 SV=2
4	Q90X27	4.27e-76	233	263	0.575	0.570	Q90X27_DANRE Transcription factor Treb5 OS=Danio rerio OX=7955 GN=cb918 PE=2 SV=1
5	F6ZM55	6.75e-20	89.0	309	0.180	0.152	F6ZM55_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=1
6	G5EE07	9.43e-16	77.0	287	0.157	0.143	XBP1_CAEEL X-box-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=xbp-1 PE=1 SV=1
7	Q5BI44	6.19e-13	69.3	307	0.165	0.140	Q5BI44_DROME LD42070p OS=Drosophila melanogaster OX=7227 GN=Xbp1 PE=2 SV=1
8	Q8MLW7	8.69e-13	69.7	498	0.165	0.086	Q8MLW7_DROME X box binding protein-1, isoform E OS=Drosophila melanogaster OX=7227 GN=Xbp1 PE=4 SV=4
9	F7BMG3	9.19e-11	63.5	437	0.134	0.080	F7BMG3_CIOIN BZIP domain-containing protein OS=Ciona intestinalis OX=7719 PE=1 SV=2
10	F6YIV7	2.72e-09	59.3	366	0.119	0.085	F6YIV7_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=xbpd PE=1 SV=2
11	O24646	1.12e-07	52.4	168	0.138	0.214	HY5_ARATH Transcription factor HY5 OS=Arabidopsis thaliana OX=3702 GN=HY5 PE=1 SV=1
12	Q4H2M1	5.77e-07	51.6	238	0.111	0.122	Q4H2M1_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-xBPb PE=1 SV=1
13	A8MS70	1.30e-06	48.9	134	0.138	0.269	A8MS70_ARATH HY5-homolog OS=Arabidopsis thaliana OX=3702 GN=HYH PE=1 SV=1
14	Q8W191	2.18e-06	48.5	149	0.138	0.242	HYH_ARATH Transcription factor HY5-like OS=Arabidopsis thaliana OX=3702 GN=HYH PE=1 SV=1
15	A2Q7D0	2.66e-06	50.1	341	0.161	0.123	A2Q7D0_ASPNC Contig An01c0020, genomic contig OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An01g00160 PE=3 SV=1
16	Q4WEY8	1.90e-05	47.4	342	0.111	0.085	HACA_ASPFU Transcriptional regulator of the unfolded protein response hacA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=hacA PE=3 SV=2
17	Q6FRZ8	2.13e-05	47.8	588	0.119	0.053	AP1_CANGA bZip transcription factor GAP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AP1 PE=3 SV=1
18	A0A1D8PN91	3.26e-05	47.0	399	0.103	0.068	A0A1D8PN91_CANAL Fcr3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=FCR3 PE=4 SV=1
19	Q8X229	3.35e-05	47.0	399	0.103	0.068	FCR3_CANAX Fluconazole resistance protein 3 OS=Candida albicans OX=5476 GN=FCR3 PE=3 SV=1
20	Q4WIA4	3.67e-05	46.6	302	0.119	0.103	Q4WIA4_ASPFU BZIP transcription factor (Fcr3), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_2G02540 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	6.5e-07	40.7	bZIP transcription factor
2	PF07716 bZIP_2	5.9e-07	40.8	Basic region leucine zipper
3	PF03131 bZIP_Maf	0.0031	29.3	bZIP Maf transcription factor
4	PF14662 KASH_CCD	6.7	18.1	Coiled-coil region of CCDC155 or KASH
5	PF06156 YabA	42	16.2	Initiation control protein YabA

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000216037

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356919	0.998	Cyclic AMP-dependent transcription factor ATF-6 alpha
2	9606.ENSP00000401445	0.997	Serine/threonine-protein kinase/endoribonuclease IRE1
3	9606.ENSP00000437955	0.992	Hypoxia-inducible factor 1-alpha
4	9606.ENSP00000473631	0.986	DnaJ homolog subfamily C member 3
5	9606.ENSP00000256497	0.983	ER degradation-enhancing alpha-mannosidase-like protein 1
6	9606.ENSP00000249356	0.980	DnaJ homolog subfamily B member 9
7	9606.ENSP00000448665	0.976	DNA damage-inducible transcript 3 protein
8	9606.ENSP00000324173	0.974	78 kDa glucose-regulated protein
9	9606.ENSP00000366395	0.962	E3 ubiquitin-protein ligase synoviolin
10	9606.ENSP00000480150	0.960	Hypoxia up-regulated protein 1
11	9606.ENSP00000414398	0.958	DnaJ homolog subfamily B member 11
12	9606.ENSP00000226760	0.957	Wolframin
13	9606.ENSP00000385385	0.957	Protein disulfide-isomerase A6
14	9606.ENSP00000420076	0.944	Stress-associated endoplasmic reticulum protein 1
15	9606.ENSP00000368880	0.941	Forkhead box protein O1
16	9606.ENSP00000349860	0.938	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1
17	9606.ENSP00000307235	0.937	Eukaryotic translation initiation factor 2-alpha kinase 3
18	9606.ENSP00000240055	0.934	Nuclear transcription factor Y subunit beta
19	9606.ENSP00000345702	0.934	Nuclear transcription factor Y subunit alpha
20	9606.ENSP00000396620	0.932	Nuclear transcription factor Y subunit gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003700	1.000	DNA-binding transcription factor activity
GO:0000976	0.998	transcription cis-regulatory region binding
GO:0000977	0.977	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0019899	0.970	enzyme binding
GO:0046983	0.954	protein dimerization activity
GO:0000987	0.942	cis-regulatory region sequence-specific DNA binding
GO:0044389	0.900	ubiquitin-like protein ligase binding
GO:0042802	0.864	identical protein binding
GO:0140297	0.763	DNA-binding transcription factor binding
GO:0061629	0.723	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0031625	0.723	ubiquitin protein ligase binding
GO:0046982	0.709	protein heterodimerization activity
GO:0019900	0.709	kinase binding
GO:0019901	0.683	protein kinase binding
GO:0042803	0.641	protein homodimerization activity
GO:0003682	0.582	chromatin binding
GO:0016922	0.563	nuclear receptor binding
GO:0031490	0.547	chromatin DNA binding
GO:0030331	0.539	nuclear estrogen receptor binding
GO:0002020	0.520	protease binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.980	cellular process
GO:0050896	0.976	response to stimulus
GO:0080090	0.975	regulation of primary metabolic process
GO:0060255	0.975	regulation of macromolecule metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0031323	0.975	regulation of cellular metabolic process
GO:0071704	0.974	organic substance metabolic process
GO:0010468	0.974	regulation of gene expression
GO:0044238	0.973	primary metabolic process
GO:0044237	0.973	cellular metabolic process
GO:1903506	0.972	regulation of nucleic acid-templated transcription
GO:0048518	0.951	positive regulation of biological process
GO:0034641	0.936	cellular nitrogen compound metabolic process
GO:0048522	0.935	positive regulation of cellular process
GO:0010467	0.927	gene expression
GO:0009059	0.925	macromolecule biosynthetic process
GO:0044271	0.920	cellular nitrogen compound biosynthetic process
GO:0010604	0.915	positive regulation of macromolecule metabolic process
GO:0006355	0.912	regulation of DNA-templated transcription
GO:0051173	0.901	positive regulation of nitrogen compound metabolic process
GO:0031325	0.895	positive regulation of cellular metabolic process
GO:0048523	0.872	negative regulation of cellular process
GO:0045935	0.860	positive regulation of nucleobase-containing compound metabolic process
GO:0009891	0.856	positive regulation of biosynthetic process
GO:0006950	0.845	response to stress
GO:0031329	0.842	regulation of cellular catabolic process
GO:0006357	0.839	regulation of transcription by RNA polymerase II
GO:0031328	0.837	positive regulation of cellular biosynthetic process
GO:0030968	0.835	endoplasmic reticulum unfolded protein response
GO:0006366	0.829	transcription by RNA polymerase II
GO:0051254	0.820	positive regulation of RNA metabolic process
GO:0010557	0.764	positive regulation of macromolecule biosynthetic process
GO:0009892	0.763	negative regulation of metabolic process
GO:0045944	0.754	positive regulation of transcription by RNA polymerase II
GO:0048583	0.746	regulation of response to stimulus
GO:0031324	0.704	negative regulation of cellular metabolic process
GO:0009605	0.660	response to external stimulus
GO:0042981	0.647	regulation of apoptotic process
GO:0048585	0.623	negative regulation of response to stimulus
GO:1901700	0.603	response to oxygen-containing compound
GO:1901564	0.504	organonitrogen compound metabolic process
GO:0010646	0.490	regulation of cell communication
GO:0023051	0.479	regulation of signaling
GO:0009966	0.451	regulation of signal transduction
GO:0032501	0.421	multicellular organismal process
GO:0032502	0.397	developmental process
GO:0080134	0.370	regulation of response to stress
GO:0051172	0.366	negative regulation of nitrogen compound metabolic process
GO:0051246	0.365	regulation of protein metabolic process
GO:0010605	0.356	negative regulation of macromolecule metabolic process
GO:0080135	0.339	regulation of cellular response to stress
GO:0071840	0.332	cellular component organization or biogenesis
GO:0048584	0.307	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.981	cytosol
GO:0070013	0.981	intracellular organelle lumen
GO:0032991	0.968	protein-containing complex
GO:0031981	0.967	nuclear lumen
GO:0005654	0.963	nucleoplasm
GO:0016020	0.926	membrane
GO:0012505	0.925	endomembrane system
GO:0005783	0.764	endoplasmic reticulum
GO:0005667	0.738	transcription regulator complex
GO:0140513	0.632	nuclear protein-containing complex
GO:0031090	0.602	organelle membrane
GO:0090575	0.599	RNA polymerase II transcription regulator complex
GO:0031984	0.378	organelle subcompartment

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]