StarFunc result for job id P17927

User Input

>input (2039 residues)
MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDE
FEFPIGTYLNYECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKG
IQFGSQIKYSCTKGYRLIGSSSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFIST
NRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCEVKSCDD
FMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF
CPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVW
SSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNL
VWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGN
AAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGE
PSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGF
VMKGPRRVKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGY
DLRGAASMRCTPQGDWSPAAPTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGF
QLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTC
DPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNA
SDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITD
IQVGSRINYSCTTGHRLIGHSSAECILSGNTAHWSTKPPICQRIPCGLPPTIANGDFIST
NRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTP
PNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPP
PEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDD
FLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIF
CPNPPAILNGRHTGTPSGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVW
SSPAPRCELSVRAGHCKTPEQFPFASPTIPINDFEFPVGTSLNYECRPGYFGKMFSISCL
ENLVWSSVEDNCRRKSCGPPPEPFNGMVHINTDTQFGSTVNYSCNEGFRLIGSPSTTCLV
SGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHNGTVVTYQCHTGPDGEQLFEL
VGERSIYCTSKDDQVGVWSSPPPRCISTNKCTAPEVENAIRVPGNRSFFSLTEIIRFRCQ
PGFVMVGSHTVQCQTNGRWGPKLPHCSRVCQPPPEILHGEHTLSHQDNFSPGQEVFYSCE
PSYDLRGAASLHCTPQGDWSPEAPRCTVKSCDDFLGQLPHGRVLLPLNLQLGAKVSFVCD
EGFRLKGRSASHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEIS
YACDTHPDRGMTFNLIGESSIRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYI
GGHVSLYLPGMTISYICDPGYLLVGKGFIFCTDQGIWSQLDHYCKEVNCSFPLFMNGISK
ELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDPPLAKCTSRTHDALIVGTLSG
TIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQTNEENSRVLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:2q7zA	0.082	0.085	0.000	1931	0.945	0.998	2q7zA.pdb.gz
2	AFDB:P17927	1.000	1.000	0.000	2039	1.000	1.000	P17927.pdb.gz	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
3	AFDB:D3Z9F7	0.089	0.161	4.242E-66	1029	0.187	0.370	D3Z9F7.pdb.gz	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
4	AFDB:P20023	0.092	0.163	4.637E-65	1033	0.194	0.383	P20023.pdb.gz	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
5	AFDB:Q2VPA4	0.140	0.451	3.783E-62	569	0.214	0.768	Q2VPA4.pdb.gz	CR1L_HUMAN Complement component receptor 1-like protein OS=Homo sapiens OX=9606 GN=CR1L PE=1 SV=3
6	PDB:2gsxA	0.080	0.139	8.903E-61	951	0.179	0.383	2gsxA.pdb.gz
7	AFDB:P08603	0.098	0.150	1.114E-59	1231	0.167	0.276	P08603.pdb.gz	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
8	AFDB:P06909	0.108	0.152	1.158E-59	1234	0.160	0.265	P06909.pdb.gz	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
9	AFDB:B7YZX0	0.070	0.080	2.385E-50	1677	0.173	0.210	B7YZX0.pdb.gz	B7YZX0_DROME Hig-anchoring scaffold protein, isoform G OS=Drosophila melanogaster OX=7227 GN=Hasp PE=1 SV=2
10	PDB:1haqA	0.075	0.106	1.077E-42	1213	0.154	0.259	1haqA.pdb.gz
11	AFDB:Q63135	0.113	0.358	2.757E-40	559	0.128	0.465	Q63135.pdb.gz	CR1L_RAT Complement component receptor 1-like protein OS=Rattus norvegicus OX=10116 GN=Cr1l PE=1 SV=1
12	AFDB:E9Q8B5	0.077	0.132	1.155E-37	879	0.119	0.275	E9Q8B5.pdb.gz	E9Q8B5_MOUSE Complement factor H-related 4 OS=Mus musculus OX=10090 GN=Cfhr4 PE=1 SV=1
13	AFDB:Q9VYR4	0.084	0.127	1.155E-37	1174	0.122	0.211	Q9VYR4.pdb.gz	Q9VYR4_DROME Furrowed, isoform A OS=Drosophila melanogaster OX=7227 GN=fw PE=2 SV=2
14	PDB:1c1zA	0.086	0.448	3.708E-14	326	0.038	0.236	1c1zA.pdb.gz
15	PDB:8a7eC	0.068	0.086	5.144E-9	1524	0.060	0.080	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
16	PDB:2xwbF	0.042	0.094	7.477E-7	714	0.020	0.057	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.
17	PDB:4e0sB	0.047	0.085	3.317E-6	898	0.029	0.066	4e0sB.pdb.gz	Crystal structure of c5b-6 suggests structural basis for priming assembly of the membrane attack complex.
18	PDB:3t5oA	0.045	0.090	9.193E-6	871	0.027	0.063	3t5oA.pdb.gz	Structure of Complement C6 Suggests a Mechanism for Initiation and Unidirectional, Sequential Assembly of Membrane Attack Complex (MAC).
19	PDB:7dvq3	0.049	0.068	9.943E-6	1193	0.064	0.109	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:8a7dQ	0.047	0.247	1.530E-5	273	0.029	0.220	8a7dQ.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z9F7	0.0	695	1406	0.236	0.343	D3Z9F7_RAT Complement C3d receptor 2 OS=Rattus norvegicus OX=10116 GN=Cr2 PE=4 SV=3
2	P17927	0.0	4184	2039	1.000	1.000	CR1_HUMAN Complement receptor type 1 OS=Homo sapiens OX=9606 GN=CR1 PE=1 SV=3
3	Q2VPA4	0.0	576	569	0.147	0.527	CR1L_HUMAN Complement component receptor 1-like protein OS=Homo sapiens OX=9606 GN=CR1L PE=1 SV=3
4	P20023	9.97e-176	566	1033	0.182	0.359	CR2_HUMAN Complement receptor type 2 OS=Homo sapiens OX=9606 GN=CR2 PE=1 SV=2
5	Q4LDE5	9.19e-172	588	3571	0.268	0.153	SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SVEP1 PE=1 SV=3
6	A2AVA0	4.20e-165	568	3567	0.267	0.153	SVEP1_MOUSE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing protein 1 OS=Mus musculus OX=10090 GN=Svep1 PE=1 SV=1
7	A0A1D5NSM8	2.70e-156	541	3615	0.269	0.152	A0A1D5NSM8_DANRE Sushi, von Willebrand factor type A, EGF and pentraxin domain-containing 1 OS=Danio rerio OX=7955 GN=svep1 PE=4 SV=1
8	P19070	8.13e-147	485	1025	0.143	0.284	CR2_MOUSE Complement receptor type 2 OS=Mus musculus OX=10090 GN=Cr2 PE=1 SV=1
9	Q63135	2.03e-124	406	559	0.115	0.420	CR1L_RAT Complement component receptor 1-like protein OS=Rattus norvegicus OX=10116 GN=Cr1l PE=1 SV=1
10	Q64735	3.79e-118	385	483	0.090	0.379	CR1L_MOUSE Complement component receptor 1-like protein OS=Mus musculus OX=10090 GN=Cr1l PE=1 SV=1
11	Q80T79	2.51e-91	335	3707	0.237	0.130	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
12	Q96PZ7	1.70e-83	309	3564	0.176	0.100	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
13	Q923L3	1.31e-82	306	3564	0.179	0.102	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
14	P08603	1.76e-74	276	1231	0.167	0.276	CFAH_HUMAN Complement factor H OS=Homo sapiens OX=9606 GN=CFH PE=1 SV=4
15	P06909	1.76e-69	260	1234	0.160	0.265	CFAH_MOUSE Complement factor H OS=Mus musculus OX=10090 GN=Cfh PE=1 SV=2
16	G3V9R2	7.93e-63	239	1235	0.163	0.270	G3V9R2_RAT Complement factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=4 SV=1
17	Q91YB6	2.49e-62	237	1236	0.164	0.270	Q91YB6_RAT Complement inhibitory factor H OS=Rattus norvegicus OX=10116 GN=Cfh PE=2 SV=1
18	Q9DEG0	5.00e-62	222	451	0.068	0.308	Q9DEG0_CHICK Complement regulatory membrane protein OS=Gallus gallus OX=9031 GN=Cremp PE=2 SV=1
19	Q63514	2.03e-56	209	558	0.083	0.305	C4BPA_RAT C4b-binding protein alpha chain OS=Rattus norvegicus OX=10116 GN=C4bpa PE=2 SV=1
20	P04003	1.70e-54	204	597	0.078	0.266	C4BPA_HUMAN C4b-binding protein alpha chain OS=Homo sapiens OX=9606 GN=C4BPA PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08410 DUF1737	5.8	18.1	Domain of unknown function (DUF1737)
2	PF12946 EGF_MSP1_1	18	16.7	MSP1 EGF domain 1
3	PF03519 Invas_SpaK	7e-05	34.3	Invasion protein B family
4	PF00084 Sushi	3.4e-270	884.2	Sushi repeat (SCR repeat)
5	PF01034 Syndecan	5.7e+02	11.8	Syndecan domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000003245

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000017648	0.993	Uncharacterized protein
2	9598.ENSPTRP00000053635	0.782	Uncharacterized protein
3	9598.ENSPTRP00000050338	0.736	Uncharacterized protein
4	9598.ENSPTRP00000054478	0.736	Uncharacterized protein
5	9598.ENSPTRP00000032202	0.721	Eukaryotic translation initiation factor 3 subunit B
6	9598.ENSPTRP00000005617	0.703	CD81 antigen
7	9598.ENSPTRP00000053492	0.674	Formin homology 2 domain containing 1
8	9598.ENSPTRP00000015627	0.671	Uncharacterized protein
9	9598.ENSPTRP00000022084	0.629	Uncharacterized protein
10	9598.ENSPTRP00000006057	0.593	CD59 molecule, complement regulatory protein
11	9598.ENSPTRP00000006415	0.588	Uncharacterized protein
12	9598.ENSPTRP00000000773	0.561	Transmembrane protein 200B
13	9598.ENSPTRP00000048059	0.533	Uncharacterized protein
14	9598.ENSPTRP00000053358	0.532	Uncharacterized protein
15	9598.ENSPTRP00000013737	0.521	Uncharacterized protein
16	9598.ENSPTRP00000003034	0.520	Uncharacterized protein
17	9598.ENSPTRP00000014826	0.517	CD68 molecule
18	9598.ENSPTRP00000054833	0.512	Integral membrane glycoprotein that plays an essential role in the immune response and serves multiple functions in responses against both external and internal offenses. In T-cells, functions primarily as a coreceptor for MHC class II molecule:peptide complex. The antigens presented by class II peptides are derived from extracellular proteins while class I peptides are derived from cytosolic proteins. Interacts simultaneously with the T-cell receptor (TCR) and the MHC class II presented by antigen presenting cells (APCs). In turn, recruits the Src kinase LCK to the vicinity of the TCR [...]
19	9598.ENSPTRP00000049050	0.508	Fc fragment of IgE receptor II
20	9598.ENSPTRP00000040980	0.506	Binds to the Fc region of immunoglobulins gamma. Low affinity receptor. By binding to IgG it initiates cellular responses against pathogens and soluble antigens. Promotes phagocytosis of opsonized antigens (By similarity)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140375	1.000	immune receptor activity
GO:0004888	1.000	transmembrane signaling receptor activity
GO:0001848	1.000	complement binding
GO:0001846	0.999	opsonin binding
GO:0001851	0.798	complement component C3b binding
GO:0004875	0.555	complement receptor activity
GO:0001855	0.536	complement component C4b binding
GO:0004877	0.536	complement component C3b receptor activity
GO:0001861	0.536	complement component C4b receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.984	regulation of biological process
GO:0050896	0.972	response to stimulus
GO:0009987	0.970	cellular process
GO:0050778	0.965	positive regulation of immune response
GO:0050794	0.964	regulation of cellular process
GO:0002252	0.945	immune effector process
GO:0002253	0.931	activation of immune response
GO:0006955	0.890	immune response
GO:0044419	0.883	biological process involved in interspecies interaction between organisms
GO:0009605	0.877	response to external stimulus
GO:0006959	0.869	humoral immune response
GO:0051716	0.859	cellular response to stimulus
GO:0001817	0.857	regulation of cytokine production
GO:0048519	0.842	negative regulation of biological process
GO:0002694	0.840	regulation of leukocyte activation
GO:0002697	0.839	regulation of immune effector process
GO:0002920	0.829	regulation of humoral immune response
GO:0030449	0.823	regulation of complement activation
GO:0032101	0.802	regulation of response to external stimulus
GO:0002703	0.797	regulation of leukocyte mediated immunity
GO:0031347	0.792	regulation of defense response
GO:0051249	0.792	regulation of lymphocyte activation
GO:0009607	0.783	response to biotic stimulus
GO:0030155	0.783	regulation of cell adhesion
GO:0006956	0.782	complement activation
GO:1902107	0.773	positive regulation of leukocyte differentiation
GO:0002706	0.769	regulation of lymphocyte mediated immunity
GO:0031341	0.761	regulation of cell killing
GO:0002822	0.749	regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0051171	0.747	regulation of nitrogen compound metabolic process
GO:0080090	0.746	regulation of primary metabolic process
GO:0002696	0.746	positive regulation of leukocyte activation
GO:0010604	0.738	positive regulation of macromolecule metabolic process
GO:0045621	0.733	positive regulation of lymphocyte differentiation
GO:0050777	0.723	negative regulation of immune response
GO:0022407	0.721	regulation of cell-cell adhesion
GO:0006950	0.713	response to stress
GO:1903037	0.707	regulation of leukocyte cell-cell adhesion
GO:0045785	0.705	positive regulation of cell adhesion
GO:0050866	0.701	negative regulation of cell activation
GO:0045582	0.701	positive regulation of T cell differentiation
GO:0050670	0.700	regulation of lymphocyte proliferation
GO:0051179	0.699	localization
GO:0002831	0.698	regulation of response to biotic stimulus
GO:0002695	0.686	negative regulation of leukocyte activation
GO:0002823	0.682	negative regulation of adaptive immune response based on somatic recombination of immune receptors built from immunoglobulin superfamily domains
GO:0002921	0.681	negative regulation of humoral immune response
GO:0032102	0.677	negative regulation of response to external stimulus
GO:0007162	0.673	negative regulation of cell adhesion
GO:0002707	0.672	negative regulation of lymphocyte mediated immunity
GO:0001818	0.672	negative regulation of cytokine production
GO:0032649	0.663	regulation of type II interferon production
GO:0002832	0.649	negative regulation of response to biotic stimulus
GO:0065009	0.642	regulation of molecular function
GO:0042129	0.631	regulation of T cell proliferation
GO:0045589	0.631	regulation of regulatory T cell differentiation
GO:0051250	0.628	negative regulation of lymphocyte activation
GO:1903038	0.626	negative regulation of leukocyte cell-cell adhesion
GO:1901264	0.625	carbohydrate derivative transport
GO:0015865	0.625	purine nucleotide transport
GO:0051246	0.623	regulation of protein metabolic process
GO:0007154	0.619	cell communication
GO:0015867	0.619	ATP transport
GO:0006952	0.618	defense response
GO:0023052	0.616	signaling
GO:0032689	0.607	negative regulation of type II interferon production
GO:0045088	0.602	regulation of innate immune response
GO:0002712	0.599	regulation of B cell mediated immunity
GO:0007165	0.598	signal transduction
GO:0002889	0.586	regulation of immunoglobulin mediated immune response
GO:0031348	0.578	negative regulation of defense response
GO:0043207	0.531	response to external biotic stimulus
GO:0045824	0.490	negative regulation of innate immune response
GO:0032501	0.452	multicellular organismal process
GO:0007166	0.397	cell surface receptor signaling pathway
GO:0051707	0.377	response to other organism
GO:0044093	0.349	positive regulation of molecular function
GO:0002699	0.326	positive regulation of immune effector process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005886	0.998	plasma membrane
GO:0005622	0.997	intracellular anatomical structure
GO:0005615	0.995	extracellular space
GO:0031982	0.992	vesicle
GO:0012505	0.991	endomembrane system
GO:0005737	0.991	cytoplasm
GO:0043231	0.988	intracellular membrane-bounded organelle
GO:0065010	0.985	extracellular membrane-bounded organelle
GO:0070062	0.979	extracellular exosome
GO:0030141	0.974	secretory granule
GO:0031090	0.969	organelle membrane
GO:0009986	0.958	cell surface
GO:0012506	0.942	vesicle membrane
GO:0098588	0.940	bounding membrane of organelle
GO:0030659	0.930	cytoplasmic vesicle membrane
GO:0043232	0.846	intracellular non-membrane-bounded organelle
GO:0070820	0.752	tertiary granule
GO:0098590	0.728	plasma membrane region
GO:0032991	0.726	protein-containing complex
GO:0030667	0.708	secretory granule membrane
GO:0098857	0.692	membrane microdomain
GO:0045121	0.586	membrane raft
GO:0101002	0.572	ficolin-1-rich granule
GO:0005856	0.392	cytoskeleton
GO:0044853	0.376	plasma membrane raft
GO:0101003	0.373	ficolin-1-rich granule membrane
GO:0070013	0.369	intracellular organelle lumen
GO:0070821	0.351	tertiary granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]