StarFunc result for job id P17931

User Input

>input (250 residues)
MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPP
GAYPGAPGAYPGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNL
PLPGGVVPRMLITILGTVKPNANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNN
WGREERQSVFPFESGKPFKIQVLVEPDHFKVAVNDAHLLQYNHRVKKLNEISKLGISGDI
DLTSASYTMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R693	0.640	0.640	6.140E-39	250	1.000	1.000	A0A024R693.pdb.gz	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	AFDB:P08699	0.679	0.649	4.498E-35	262	0.836	0.798	P08699.pdb.gz	LEG3_RAT Galectin-3 OS=Rattus norvegicus OX=10116 GN=Lgals3 PE=1 SV=4
3	AFDB:O08573	0.526	0.376	1.080E-17	353	0.260	0.184	O08573.pdb.gz	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
4	AFDB:P97840	0.510	0.363	1.202E-17	354	0.272	0.192	P97840.pdb.gz	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
5	AFDB:Q3B8N2	0.523	0.369	1.654E-17	356	0.300	0.211	Q3B8N2.pdb.gz	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
6	AFDB:Q6DGJ1	0.497	0.877	2.376E-16	139	0.192	0.345	Q6DGJ1.pdb.gz	GRIFN_DANRE Grifin OS=Danio rerio OX=7955 GN=grifin PE=1 SV=1
7	AFDB:J3KS82	0.521	0.738	5.573E-16	175	0.216	0.309	J3KS82.pdb.gz	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
8	AFDB:J3QR96	0.520	0.528	2.112E-15	246	0.220	0.224	J3QR96.pdb.gz	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
9	AFDB:Q9JL15	0.519	0.412	2.349E-15	316	0.216	0.171	Q9JL15.pdb.gz	LEG8_MOUSE Galectin-8 OS=Mus musculus OX=10090 GN=Lgals8 PE=1 SV=1
10	AFDB:O00214	0.517	0.410	3.067E-15	317	0.224	0.177	O00214.pdb.gz	LEG8_HUMAN Galectin-8 OS=Homo sapiens OX=9606 GN=LGALS8 PE=1 SV=4
11	PDB:3zxfB	0.494	0.876	4.753E-14	138	0.200	0.362	3zxfB.pdb.gz
12	PDB:5xg7A	0.493	0.871	3.561E-12	139	0.156	0.281	5xg7A.pdb.gz
13	PDB:6l6aA	0.499	0.861	5.753E-12	142	0.140	0.246	6l6aA.pdb.gz	Structures of human galectin-10/monosaccharide complexes demonstrate potential of monosaccharides as effectors in forming Charcot-Leyden crystals.
14	PDB:6ljqA	0.486	0.850	6.400E-12	140	0.152	0.271	6ljqA.pdb.gz	Human galectin-16 has a pseudo ligand binding site and plays a role in regulating c-Rel-mediated lymphocyte activity.
15	PDB:3vv1A	0.493	0.858	1.034E-11	141	0.116	0.206	3vv1A.pdb.gz	Structural basis of preferential binding of fucose-containing saccharide by the Caenorhabditis elegans galectin LEC-6
16	PDB:4ga9A	0.467	0.833	1.034E-11	134	0.132	0.246	4ga9A.pdb.gz	Gal-1 structure analysis
17	PDB:1w6mA	0.473	0.850	2.698E-11	134	0.148	0.276	1w6mA.pdb.gz	Growth-Regulatory Human Galectin-1: Crystallographic Characterisation of the Structural Changes Induced by Single-Site Mutations and Their Impact on the Thermodynamics of Ligand Binding.
18	PDB:6e20B	0.449	0.814	3.339E-11	133	0.124	0.233	6e20B.pdb.gz	Structure of the zebrafish galectin-1-L2 and model of its interaction with the infectious hematopoietic necrosis virus (IHNV) envelope glycoprotein.
19	PDB:6k2zA	0.404	0.714	7.426E-11	138	0.156	0.283	6k2zA.pdb.gz	Structure-function studies of galectin-14, an important effector molecule in embryology.
20	PDB:5dg2B	0.452	0.829	7.832E-11	131	0.152	0.290	5dg2B.pdb.gz	Human galectin-2 interacts with carbohydrates and peptides non-classically: new insight from X-ray crystallography and hemagglutination.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R693	0.0	498	250	1.000	1.000	A0A024R693_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
2	P17931	0.0	498	250	1.000	1.000	LEG3_HUMAN Galectin-3 OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=5
3	Q6NVH9	1.15e-177	489	250	0.988	0.988	Q6NVH9_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
4	P08699	4.77e-145	408	262	0.836	0.798	LEG3_RAT Galectin-3 OS=Rattus norvegicus OX=10116 GN=Lgals3 PE=1 SV=4
5	P16110	5.29e-144	405	264	0.836	0.792	LEG3_MOUSE Galectin-3 OS=Mus musculus OX=10090 GN=Lgals3 PE=1 SV=3
6	G3V3R6	7.74e-140	393	233	0.800	0.858	G3V3R6_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
7	G3V407	2.77e-50	161	88	0.352	1.000	G3V407_HUMAN Galectin 3 (Fragment) OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
8	O08573	1.02e-31	121	353	0.248	0.176	LEG9_MOUSE Galectin-9 OS=Mus musculus OX=10090 GN=Lgals9 PE=1 SV=1
9	O00182	7.08e-30	116	355	0.288	0.203	LEG9_HUMAN Galectin-9 OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=2
10	J3KSY2	7.98e-29	113	323	0.256	0.198	J3KSY2_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
11	P97840	8.60e-29	113	354	0.240	0.169	LEG9_RAT Galectin-9 OS=Rattus norvegicus OX=10116 GN=Lgals9 PE=2 SV=2
12	Q3B8N2	5.18e-28	111	356	0.232	0.163	LEG9B_HUMAN Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3
13	Q6DKI2	5.29e-28	111	356	0.232	0.163	LEG9C_HUMAN Galectin-9C OS=Homo sapiens OX=9606 GN=LGALS9C PE=1 SV=2
14	Q6DGJ1	1.45e-27	104	139	0.196	0.353	GRIFN_DANRE Grifin OS=Danio rerio OX=7955 GN=grifin PE=1 SV=1
15	J3KS82	7.86e-27	103	175	0.228	0.326	J3KS82_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9 PE=1 SV=1
16	J3QSH0	4.16e-26	102	175	0.228	0.326	J3QSH0_HUMAN Galectin (Fragment) OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
17	J3KT17	7.68e-26	103	234	0.228	0.244	J3KT17_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
18	J3QR96	8.68e-26	103	246	0.228	0.232	J3QR96_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS9C PE=4 SV=1
19	Q8K419	4.53e-25	103	326	0.204	0.156	LEG4_MOUSE Galectin-4 OS=Mus musculus OX=10090 GN=Lgals4 PE=1 SV=2
20	O54891	1.03e-24	101	301	0.216	0.179	LEG6_MOUSE Galectin-6 OS=Mus musculus OX=10090 GN=Lgals6 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00337 Gal-bind_lectin	6e-34	127.9	Galactoside-binding lectin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254301

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262776	0.998	Galectin-3-binding protein
2	9606.ENSP00000407586	0.996	GTPase HRas
3	9606.ENSP00000275493	0.995	Epidermal growth factor receptor
4	9606.ENSP00000358918	0.992	Suppressor of fused homolog
5	9606.ENSP00000302569	0.991	C-type lectin domain family 7 member A
6	9606.ENSP00000346839	0.990	Fibronectin type III domain containing
7	9606.ENSP00000321706	0.989	Gem-associated protein 4
8	9606.ENSP00000484824	0.989	Mucin-1
9	9606.ENSP00000256078	0.988	GTPase KRas
10	9606.ENSP00000344456	0.988	Catenin beta-1
11	9606.ENSP00000203629	0.987	Lymphocyte activation gene 3 protein
12	9606.ENSP00000363089	0.985	Toll-like receptor 4
13	9606.ENSP00000411355	0.983	Receptor-type tyrosine-protein phosphatase C
14	9606.ENSP00000381008	0.981	Mucin-16
15	9606.ENSP00000260010	0.979	Toll-like receptor 2
16	9606.ENSP00000463188	0.977	Tripartite motif-containing protein 16
17	9606.ENSP00000300060	0.969	Aminopeptidase N
18	9606.ENSP00000379350	0.969	Integrin beta-1
19	9606.ENSP00000295408	0.963	Tyrosine-protein kinase Mer
20	9606.ENSP00000417498	0.960	Mucin-4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0030246	0.959	carbohydrate binding
GO:0005102	0.553	signaling receptor binding
GO:0038023	0.419	signaling receptor activity
GO:0044877	0.361	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0051049	0.998	regulation of transport
GO:0048523	0.997	negative regulation of cellular process
GO:0009987	0.994	cellular process
GO:0050896	0.991	response to stimulus
GO:0048583	0.988	regulation of response to stimulus
GO:0048518	0.988	positive regulation of biological process
GO:0002694	0.987	regulation of leukocyte activation
GO:0060627	0.986	regulation of vesicle-mediated transport
GO:0048522	0.983	positive regulation of cellular process
GO:0051249	0.979	regulation of lymphocyte activation
GO:0009966	0.976	regulation of signal transduction
GO:0048856	0.965	anatomical structure development
GO:0042127	0.958	regulation of cell population proliferation
GO:0048585	0.952	negative regulation of response to stimulus
GO:0070663	0.949	regulation of leukocyte proliferation
GO:0060548	0.937	negative regulation of cell death
GO:0042981	0.915	regulation of apoptotic process
GO:0032501	0.913	multicellular organismal process
GO:0042221	0.911	response to chemical
GO:0051716	0.910	cellular response to stimulus
GO:0010648	0.901	negative regulation of cell communication
GO:0022407	0.898	regulation of cell-cell adhesion
GO:0051050	0.893	positive regulation of transport
GO:0043069	0.886	negative regulation of programmed cell death
GO:0023057	0.882	negative regulation of signaling
GO:0050863	0.881	regulation of T cell activation
GO:0043066	0.880	negative regulation of apoptotic process
GO:1903037	0.871	regulation of leukocyte cell-cell adhesion
GO:0009968	0.865	negative regulation of signal transduction
GO:0002683	0.862	negative regulation of immune system process
GO:0030334	0.862	regulation of cell migration
GO:0019222	0.855	regulation of metabolic process
GO:0009605	0.844	response to external stimulus
GO:0080090	0.843	regulation of primary metabolic process
GO:0060255	0.829	regulation of macromolecule metabolic process
GO:0051128	0.826	regulation of cellular component organization
GO:0002376	0.824	immune system process
GO:0051246	0.821	regulation of protein metabolic process
GO:0051241	0.811	negative regulation of multicellular organismal process
GO:0031323	0.809	regulation of cellular metabolic process
GO:0065009	0.800	regulation of molecular function
GO:0050866	0.800	negative regulation of cell activation
GO:0051051	0.799	negative regulation of transport
GO:0007162	0.789	negative regulation of cell adhesion
GO:0071840	0.770	cellular component organization or biogenesis
GO:0051240	0.750	positive regulation of multicellular organismal process
GO:0002684	0.726	positive regulation of immune system process
GO:0030100	0.725	regulation of endocytosis
GO:0022408	0.719	negative regulation of cell-cell adhesion
GO:0051172	0.701	negative regulation of nitrogen compound metabolic process
GO:0044092	0.700	negative regulation of molecular function
GO:0010605	0.693	negative regulation of macromolecule metabolic process
GO:0031399	0.667	regulation of protein modification process
GO:0031324	0.665	negative regulation of cellular metabolic process
GO:0045806	0.644	negative regulation of endocytosis
GO:0050790	0.629	regulation of catalytic activity
GO:0006950	0.622	response to stress
GO:0019220	0.608	regulation of phosphate metabolic process
GO:0002695	0.558	negative regulation of leukocyte activation
GO:0043270	0.557	positive regulation of monoatomic ion transport
GO:0050900	0.505	leukocyte migration
GO:0035303	0.482	regulation of dephosphorylation
GO:1903038	0.482	negative regulation of leukocyte cell-cell adhesion
GO:0045936	0.480	negative regulation of phosphate metabolic process
GO:0008285	0.465	negative regulation of cell population proliferation
GO:0050793	0.434	regulation of developmental process
GO:0009893	0.430	positive regulation of metabolic process
GO:0016043	0.424	cellular component organization
GO:0070887	0.422	cellular response to chemical stimulus
GO:0050776	0.411	regulation of immune response
GO:0048584	0.406	positive regulation of response to stimulus
GO:0010604	0.395	positive regulation of macromolecule metabolic process
GO:0007275	0.386	multicellular organism development
GO:0030335	0.361	positive regulation of cell migration
GO:0007154	0.349	cell communication
GO:2000106	0.349	regulation of leukocyte apoptotic process
GO:0010468	0.346	regulation of gene expression
GO:0008152	0.341	metabolic process
GO:0002697	0.340	regulation of immune effector process
GO:0007165	0.330	signal transduction
GO:0071704	0.326	organic substance metabolic process
GO:0010033	0.325	response to organic substance
GO:0051248	0.301	negative regulation of protein metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0005886	0.995	plasma membrane
GO:0005576	0.990	extracellular region
GO:0005829	0.981	cytosol
GO:0005654	0.975	nucleoplasm
GO:0005615	0.963	extracellular space
GO:0031982	0.863	vesicle
GO:0012505	0.841	endomembrane system
GO:1903561	0.743	extracellular vesicle
GO:0070062	0.708	extracellular exosome
GO:0031410	0.548	cytoplasmic vesicle
GO:0031090	0.513	organelle membrane
GO:0030141	0.409	secretory granule
GO:0009986	0.353	cell surface
GO:0031012	0.307	extracellular matrix

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]