StarFunc result for job id P17936

User Input

>input (291 residues)
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17936	1.000	1.000	2.004E-56	291	1.000	1.000	P17936.pdb.gz	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
2	AFDB:P15473	0.539	0.538	1.133E-41	292	0.821	0.818	P15473.pdb.gz	IBP3_RAT Insulin-like growth factor-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Igfbp3 PE=1 SV=2
3	AFDB:I6XXP7	0.350	0.350	2.542E-40	291	0.832	0.832	I6XXP7.pdb.gz	I6XXP7_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IgFBp3 PE=4 SV=1
4	AFDB:Q66I28	0.297	0.296	2.076E-28	292	0.529	0.527	Q66I28.pdb.gz	Q66I28_DANRE Insulin-like growth factor-binding protein 3 OS=Danio rerio OX=7955 GN=IGFBP-3 PE=2 SV=1
5	AFDB:P24593	0.543	0.574	6.292E-26	272	0.426	0.456	P24593.pdb.gz	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
6	AFDB:Q90WV8	0.516	0.559	1.303E-23	265	0.399	0.438	Q90WV8.pdb.gz	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
7	PDB:7wrqB	0.458	0.738	2.514E-22	167	0.574	1.000	7wrqB.pdb.gz
8	AFDB:P22692	0.550	0.613	3.065E-21	258	0.316	0.357	P22692.pdb.gz	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
9	AFDB:P47877	0.296	0.283	6.162E-21	305	0.330	0.315	P47877.pdb.gz	IBP2_MOUSE Insulin-like growth factor-binding protein 2 OS=Mus musculus OX=10090 GN=Igfbp2 PE=2 SV=2
10	AFDB:P18065	0.304	0.275	9.019E-21	325	0.330	0.295	P18065.pdb.gz	IBP2_HUMAN Insulin-like growth factor-binding protein 2 OS=Homo sapiens OX=9606 GN=IGFBP2 PE=1 SV=2
11	AFDB:P13384	0.318	0.296	1.499E-20	317	0.316	0.290	P13384.pdb.gz	IBP2_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus OX=9913 GN=IGFBP2 PE=1 SV=2
12	PDB:5epmC	0.090	0.634	1.527	33	0.027	0.242	5epmC.pdb.gz
13	PDB:1hrtI	0.070	0.269	2.235	65	0.027	0.123	1hrtI.pdb.gz
14	PDB:4rerA	0.107	0.079	3.271	459	0.065	0.041	4rerA.pdb.gz	Structural basis of AMPK regulation by adenine nucleotides and glycogen.
15	PDB:6epcJ	0.071	0.053	3.271	406	0.065	0.047	6epcJ.pdb.gz	In Situ Structure of Neuronal C9orf72 Poly-GA Aggregates Reveals Proteasome Recruitment.
16	PDB:5irxF	0.093	0.313	5.102	75	0.031	0.120	5irxF.pdb.gz	TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action.
17	PDB:2fdjA	0.060	0.075	6.172	207	0.017	0.024	2fdjA.pdb.gz	Crystal structures of catalytic complexes of the oxidative DNA/RNA repair enzyme AlkB.
18	PDB:2z4hB	0.078	0.109	6.172	194	0.038	0.057	2z4hB.pdb.gz
19	PDB:1bu8A	0.081	0.055	7.008	446	0.010	0.007	1bu8A.pdb.gz
20	PDB:2nxfA	0.059	0.057	7.008	314	0.041	0.038	2nxfA.pdb.gz	Crystal Structure of a dimetal phosphatase from Danio rerio LOC 393393

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17936	0.0	595	291	1.000	1.000	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
2	I6XXP7	9.72e-166	463	291	0.832	0.832	I6XXP7_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IgFBp3 PE=4 SV=1
3	P20959	9.72e-166	463	291	0.832	0.832	IBP3_BOVIN Insulin-like growth factor-binding protein 3 OS=Bos taurus OX=9913 GN=IGFBP3 PE=1 SV=3
4	P15473	5.61e-157	441	292	0.821	0.818	IBP3_RAT Insulin-like growth factor-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Igfbp3 PE=1 SV=2
5	P47878	2.09e-156	439	292	0.818	0.815	IBP3_MOUSE Insulin-like growth factor-binding protein 3 OS=Mus musculus OX=10090 GN=Igfbp3 PE=2 SV=2
6	Q66I28	9.56e-90	270	292	0.502	0.500	Q66I28_DANRE Insulin-like growth factor-binding protein 3 OS=Danio rerio OX=7955 GN=IGFBP-3 PE=2 SV=1
7	Q07079	7.19e-72	224	271	0.416	0.446	IBP5_MOUSE Insulin-like growth factor-binding protein 5 OS=Mus musculus OX=10090 GN=Igfbp5 PE=1 SV=1
8	P24594	2.70e-71	223	271	0.412	0.443	IBP5_RAT Insulin-like growth factor-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Igfbp5 PE=1 SV=1
9	B3GS77	4.85e-71	222	271	0.412	0.443	B3GS77_SHEEP Insulin-like growth factor-binding protein 5 OS=Ovis aries OX=9940 GN=IGFBP5 PE=2 SV=1
10	Q05717	1.95e-70	220	271	0.409	0.439	IBP5_BOVIN Insulin-like growth factor-binding protein 5 OS=Bos taurus OX=9913 GN=IGFBP5 PE=2 SV=2
11	P24593	6.13e-70	219	272	0.409	0.438	IBP5_HUMAN Insulin-like growth factor-binding protein 5 OS=Homo sapiens OX=9606 GN=IGFBP5 PE=1 SV=1
12	Q90WV8	2.05e-63	202	265	0.378	0.415	IBP5_XENLA Insulin-like growth factor-binding protein 5 OS=Xenopus laevis OX=8355 GN=igfbp5 PE=2 SV=1
13	Q90YJ7	1.34e-40	143	262	0.344	0.382	Q90YJ7_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=IGFBP-1 PE=2 SV=1
14	Q8JHX6	3.18e-40	142	262	0.351	0.389	Q8JHX6_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1a PE=2 SV=1
15	P47877	8.09e-38	137	305	0.313	0.298	IBP2_MOUSE Insulin-like growth factor-binding protein 2 OS=Mus musculus OX=10090 GN=Igfbp2 PE=2 SV=2
16	P12843	9.77e-38	137	304	0.313	0.299	IBP2_RAT Insulin-like growth factor-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Igfbp2 PE=1 SV=3
17	P47879	7.80e-37	133	254	0.306	0.350	IBP4_MOUSE Insulin-like growth factor-binding protein 4 OS=Mus musculus OX=10090 GN=Igfbp4 PE=1 SV=2
18	P21744	8.05e-37	133	254	0.306	0.350	IBP4_RAT Insulin-like growth factor-binding protein 4 OS=Rattus norvegicus OX=10116 GN=Igfbp4 PE=1 SV=2
19	P22692	1.24e-36	133	258	0.302	0.341	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
20	P21743	3.29e-32	122	272	0.302	0.324	IBP1_RAT Insulin-like growth factor-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igfbp1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00219 IGFBP	2.8e-07	42.3	Insulin-like growth factor binding protein
2	PF00086 Thyroglobulin_1	1.1e-15	68.3	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000001536

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000004843	0.995	Insulin-like growth factor 1 (somatomedin C)
2	9593.ENSGGOP00000003893	0.977	Insulin-like growth factor 2 (somatomedin A)
3	9593.ENSGGOP00000006124	0.882	Insulin-like growth factor binding protein, acid labile subunit
4	9593.ENSGGOP00000010048	0.850	Plasminogen
5	9593.ENSGGOP00000009561	0.791	Cellular tumor antigen p53
6	9593.ENSGGOP00000014657	0.763	Fibronectin 1
7	9593.ENSGGOP00000007465	0.728	Receptor protein-tyrosine kinase
8	9593.ENSGGOP00000011677	0.728	Transmembrane protein 219
9	9593.ENSGGOP00000019150	0.726	Kallikrein-related peptidase 3
10	9593.ENSGGOP00000022437	0.720	Caveolin-1
11	9593.ENSGGOP00000009529	0.719	Retinoid X receptor, alpha
12	9593.ENSGGOP00000018503	0.695	Matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)
13	9593.ENSGGOP00000013442	0.683	Cathepsin G
14	9593.ENSGGOP00000012796	0.678	Peroxisome proliferator-activated receptor gamma
15	9593.ENSGGOP00000012531	0.669	Tyrosine-protein kinase receptor
16	9593.ENSGGOP00000015684	0.666	Lipoprotein(a)
17	9593.ENSGGOP00000021562	0.666	Uncharacterized protein
18	9593.ENSGGOP00000017817	0.659	Heat shock protein family A (Hsp70) member 5
19	9593.ENSGGOP00000023678	0.659	Heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa)
20	9593.ENSGGOP00000008675	0.653	Matrix metallopeptidase 1 (interstitial collagenase)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005520	1.000	insulin-like growth factor binding
GO:0031994	0.994	insulin-like growth factor I binding
GO:0098772	0.799	molecular function regulator activity
GO:0140677	0.723	molecular function activator activity
GO:0030234	0.529	enzyme regulator activity
GO:0031995	0.514	insulin-like growth factor II binding
GO:0019888	0.447	protein phosphatase regulator activity
GO:0008047	0.438	enzyme activator activity
GO:0072542	0.426	protein phosphatase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.988	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0048518	0.942	positive regulation of biological process
GO:0048519	0.934	negative regulation of biological process
GO:0042221	0.915	response to chemical
GO:0048523	0.903	negative regulation of cellular process
GO:0048522	0.881	positive regulation of cellular process
GO:0019222	0.879	regulation of metabolic process
GO:0051716	0.872	cellular response to stimulus
GO:0080090	0.856	regulation of primary metabolic process
GO:0060255	0.856	regulation of macromolecule metabolic process
GO:0031323	0.834	regulation of cellular metabolic process
GO:0051171	0.823	regulation of nitrogen compound metabolic process
GO:0048583	0.817	regulation of response to stimulus
GO:0007165	0.807	signal transduction
GO:0032868	0.788	response to insulin
GO:0008152	0.744	metabolic process
GO:0023051	0.734	regulation of signaling
GO:0010646	0.730	regulation of cell communication
GO:0032502	0.688	developmental process
GO:0042127	0.671	regulation of cell population proliferation
GO:0032501	0.615	multicellular organismal process
GO:0009966	0.577	regulation of signal transduction
GO:0071704	0.562	organic substance metabolic process
GO:0009893	0.552	positive regulation of metabolic process
GO:1902531	0.544	regulation of intracellular signal transduction
GO:0048856	0.514	anatomical structure development
GO:0044238	0.506	primary metabolic process
GO:0051246	0.488	regulation of protein metabolic process
GO:0048584	0.485	positive regulation of response to stimulus
GO:0006807	0.468	nitrogen compound metabolic process
GO:0009967	0.466	positive regulation of signal transduction
GO:0030334	0.458	regulation of cell migration
GO:0044237	0.447	cellular metabolic process
GO:0010604	0.441	positive regulation of macromolecule metabolic process
GO:0019220	0.439	regulation of phosphate metabolic process
GO:0009892	0.434	negative regulation of metabolic process
GO:0010941	0.424	regulation of cell death
GO:0050793	0.422	regulation of developmental process
GO:0043170	0.416	macromolecule metabolic process
GO:0010605	0.414	negative regulation of macromolecule metabolic process
GO:0070887	0.413	cellular response to chemical stimulus
GO:0031399	0.399	regulation of protein modification process
GO:0042325	0.394	regulation of phosphorylation
GO:1901564	0.385	organonitrogen compound metabolic process
GO:0007275	0.381	multicellular organism development
GO:0006950	0.377	response to stress
GO:0043067	0.376	regulation of programmed cell death
GO:0031325	0.370	positive regulation of cellular metabolic process
GO:0051173	0.367	positive regulation of nitrogen compound metabolic process
GO:0042981	0.366	regulation of apoptotic process
GO:0001932	0.362	regulation of protein phosphorylation
GO:0051172	0.360	negative regulation of nitrogen compound metabolic process
GO:0051239	0.334	regulation of multicellular organismal process
GO:0019538	0.319	protein metabolic process
GO:0045595	0.316	regulation of cell differentiation
GO:0031326	0.315	regulation of cellular biosynthetic process
GO:0008285	0.308	negative regulation of cell population proliferation
GO:0031324	0.304	negative regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0070013	0.951	intracellular organelle lumen
GO:0043231	0.888	intracellular membrane-bounded organelle
GO:0005737	0.873	cytoplasm
GO:0012505	0.749	endomembrane system
GO:0032991	0.486	protein-containing complex
GO:0042567	0.375	insulin-like growth factor ternary complex
GO:0031981	0.339	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]