StarFunc result for job id P17947

User Input

>input (270 residues)
MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHS
EFESFAENNFTELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQ
YPSLSPAQPSSDEEEGERQSPPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLL
RSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKGNRKKMTYQKMARALRNYGKTGE
VKKVKKKLTYQFSGEVLGRGGLAERRHPPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P17947	0.999	0.999	2.238E-46	270	1.000	1.000	P17947.pdb.gz	SPI1_HUMAN Transcription factor PU.1 OS=Homo sapiens OX=9606 GN=SPI1 PE=1 SV=2
2	AFDB:P17433	0.631	0.627	2.388E-38	272	0.885	0.879	P17433.pdb.gz	SPI1_MOUSE Transcription factor PU.1 OS=Mus musculus OX=10090 GN=Spi1 PE=1 SV=2
3	AFDB:Q8N5J4	0.372	0.403	5.068E-14	248	0.259	0.282	Q8N5J4.pdb.gz	SPIC_HUMAN Transcription factor Spi-C OS=Homo sapiens OX=9606 GN=SPIC PE=1 SV=1
4	AFDB:Q6P3D7	0.354	0.393	8.855E-14	242	0.241	0.269	Q6P3D7.pdb.gz	SPIC_MOUSE Transcription factor Spi-C OS=Mus musculus OX=10090 GN=Spic PE=1 SV=1
5	AFDB:O00321	0.319	0.256	1.900E-7	342	0.219	0.173	O00321.pdb.gz	ETV2_HUMAN ETS translocation variant 2 OS=Homo sapiens OX=9606 GN=ETV2 PE=2 SV=2
6	AFDB:P41163	0.326	0.267	7.151E-7	335	0.215	0.173	P41163.pdb.gz	ETV2_MOUSE ETS translocation variant 2 OS=Mus musculus OX=10090 GN=Etv2 PE=2 SV=2
7	AFDB:P41164	0.345	0.204	3.318E-6	477	0.248	0.140	P41164.pdb.gz	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1
8	AFDB:Q9EQY2	0.300	0.150	5.043E-6	579	0.189	0.088	Q9EQY2.pdb.gz
9	AFDB:Q9PUQ1	0.306	0.176	7.663E-6	494	0.226	0.123	Q9PUQ1.pdb.gz	ETV4_DANRE ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2
10	AFDB:Q30JB6	0.304	0.228	1.651E-5	366	0.256	0.189	Q30JB6.pdb.gz	Q30JB6_DANRE ETS variant transcription factor 2 OS=Danio rerio OX=7955 GN=etv2 PE=2 SV=1
11	PDB:7pzyL	0.147	0.360	2.122E-1	93	0.037	0.108	7pzyL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.
12	PDB:3cuqC	0.105	0.157	2.805E-1	173	0.056	0.087	3cuqC.pdb.gz
13	PDB:4ev0D	0.183	0.224	3.976E-1	214	0.059	0.075	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
14	PDB:4mtdD	0.158	0.243	6.478E-1	151	0.063	0.113	4mtdD.pdb.gz	Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
15	PDB:5datC0	0.118	0.302	6.946E-1	96	0.030	0.083	5datC0.pdb.gz	Coping with proline stalling: structural basis of hypusine-induced protein synthesis by the eukaryotic ribosome
16	PDB:2zcwA	0.198	0.257	7.448E-1	194	0.056	0.077	2zcwA.pdb.gz
17	PDB:1ft9A	0.120	0.151	7.986E-1	210	0.026	0.033	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.
18	PDB:5v8f4	0.146	0.067	1.132	741	0.048	0.018	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
19	PDB:1ldjA	0.166	0.071	1.214	725	0.041	0.015	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
20	PDB:5afqB	0.135	0.086	1.214	444	0.030	0.018	5afqB.pdb.gz	Structural Analysis of Human Rpc32Beta - Rpc62 Complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17947	0.0	558	270	1.000	1.000	SPI1_HUMAN Transcription factor PU.1 OS=Homo sapiens OX=9606 GN=SPI1 PE=1 SV=2
2	Q6BDS1	2.44e-178	493	271	0.893	0.889	SPI1_RAT Transcription factor PU.1 OS=Rattus norvegicus OX=10116 GN=Spi1 PE=1 SV=1
3	P17433	2.40e-175	486	272	0.885	0.879	SPI1_MOUSE Transcription factor PU.1 OS=Mus musculus OX=10090 GN=Spi1 PE=1 SV=2
4	F5H3K6	3.25e-118	340	245	0.611	0.673	F5H3K6_HUMAN Spi-1 proto-oncogene OS=Homo sapiens OX=9606 GN=SPI1 PE=1 SV=1
5	Q8AW41	2.51e-92	275	265	0.574	0.585	Q8AW41_DANRE SI:bY184L24.2.2 (Transcription factor spi1) OS=Danio rerio OX=7955 GN=spi1 PE=3 SV=1
6	F1R668	1.95e-91	273	266	0.570	0.579	F1R668_DANRE Spi-1 proto-oncogene b OS=Danio rerio OX=7955 GN=cb1086 PE=3 SV=1
7	Q78AM8	2.32e-87	263	296	0.537	0.490	Q78AM8_DANRE SI:bY184L24.2.1 (Transcription factor spi1) OS=Danio rerio OX=7955 GN=spi1 PE=3 SV=1
8	F1QFB6	2.48e-71	221	257	0.485	0.510	F1QFB6_DANRE Spi-1 proto-oncogene a OS=Danio rerio OX=7955 GN=spi1l PE=3 SV=2
9	Q01892	2.59e-50	168	262	0.426	0.439	SPIB_HUMAN Transcription factor Spi-B OS=Homo sapiens OX=9606 GN=SPIB PE=1 SV=1
10	O35906	1.82e-44	153	267	0.296	0.300	SPIB_MOUSE Transcription factor Spi-B OS=Mus musculus OX=10090 GN=Spib PE=1 SV=2
11	Q0P4E9	9.12e-35	127	247	0.311	0.340	Q0P4E9_DANRE Spi-1 proto-oncogene a OS=Danio rerio OX=7955 GN=spi1l PE=2 SV=1
12	Q8N5J4	2.65e-33	123	248	0.222	0.242	SPIC_HUMAN Transcription factor Spi-C OS=Homo sapiens OX=9606 GN=SPIC PE=1 SV=1
13	Q6P3D7	3.01e-32	120	242	0.204	0.227	SPIC_MOUSE Transcription factor Spi-C OS=Mus musculus OX=10090 GN=Spic PE=1 SV=1
14	Q00422	4.06e-12	67.8	454	0.219	0.130	GABPA_MOUSE GA-binding protein alpha chain OS=Mus musculus OX=10090 GN=Gabpa PE=1 SV=2
15	A8IE48	1.15e-11	66.6	454	0.144	0.086	A8IE48_HUMAN GA binding protein transcription factor alpha subunit 60kDa OS=Homo sapiens OX=9606 GN=GABPA PE=2 SV=1
16	Q06546	1.15e-11	66.6	454	0.144	0.086	GABPA_HUMAN GA-binding protein alpha chain OS=Homo sapiens OX=9606 GN=GABPA PE=1 SV=1
17	Q9UKW6	2.35e-10	61.6	265	0.133	0.136	ELF5_HUMAN ETS-related transcription factor Elf-5 OS=Homo sapiens OX=9606 GN=ELF5 PE=1 SV=2
18	Q8VDK3	2.97e-10	61.2	253	0.133	0.142	ELF5_MOUSE ETS-related transcription factor Elf-5 OS=Mus musculus OX=10090 GN=Elf5 PE=2 SV=2
19	A4GTP4	2.09e-09	59.7	427	0.119	0.075	ELK1_RAT ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1
20	A8WFJ9	2.31e-09	59.7	437	0.130	0.080	ETS4_CAEEL Transcription factor ets-4 OS=Caenorhabditis elegans OX=6239 GN=ets-4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	2.6e-22	90.2	Ets-domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000017707

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000012479	0.976	Colony stimulating factor 1 receptor
2	61853.ENSNLEP00000013911	0.971	Interferon regulatory factor 8
3	61853.ENSNLEP00000005245	0.955	Runt-related transcription factor
4	61853.ENSNLEP00000012925	0.934	Interferon regulatory factor 4
5	61853.ENSNLEP00000017469	0.907	Uncharacterized protein
6	61853.ENSNLEP00000000457	0.904	Fms-related tyrosine kinase 3
7	61853.ENSNLEP00000017404	0.897	GATA binding protein 2
8	61853.ENSNLEP00000023535	0.897	TATA box binding protein
9	61853.ENSNLEP00000018748	0.889	E1A binding protein p300
10	61853.ENSNLEP00000002184	0.886	Retinoic acid receptor, alpha
11	61853.ENSNLEP00000014009	0.883	Colony stimulating factor 3 receptor (granulocyte)
12	61853.ENSNLEP00000010012	0.858	Uncharacterized protein
13	61853.ENSNLEP00000003275	0.852	Lymphocyte cytosolic protein 1 (L-plastin)
14	61853.ENSNLEP00000021949	0.851	Protein tyrosine phosphatase, receptor type, C
15	61853.ENSNLEP00000003326	0.849	RUNX1 translocation partner 1
16	61853.ENSNLEP00000019891	0.843	Uncharacterized protein
17	61853.ENSNLEP00000011329	0.839	Monocyte differentiation antigen CD14
18	61853.ENSNLEP00000009603	0.833	GATA binding protein 1 (globin transcription factor 1)
19	61853.ENSNLEP00000018188	0.831	CCAAT/enhancer binding protein (C/EBP), epsilon
20	61853.ENSNLEP00000014111	0.830	TYRO protein tyrosine kinase binding protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000977	0.998	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001216	0.995	DNA-binding transcription activator activity
GO:0000978	0.993	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0008134	0.901	transcription factor binding
GO:0140297	0.870	DNA-binding transcription factor binding
GO:0001217	0.837	DNA-binding transcription repressor activity
GO:0061629	0.825	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0097677	0.599	STAT family protein binding
GO:0060090	0.513	molecular adaptor activity
GO:0000981	0.419	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0001228	0.351	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0048856	0.987	anatomical structure development
GO:0010468	0.987	regulation of gene expression
GO:0050896	0.985	response to stimulus
GO:0048518	0.985	positive regulation of biological process
GO:0080090	0.985	regulation of primary metabolic process
GO:0031323	0.985	regulation of cellular metabolic process
GO:0006355	0.983	regulation of DNA-templated transcription
GO:0010604	0.977	positive regulation of macromolecule metabolic process
GO:0048522	0.968	positive regulation of cellular process
GO:0030097	0.968	hemopoiesis
GO:0032501	0.963	multicellular organismal process
GO:0031325	0.953	positive regulation of cellular metabolic process
GO:0048519	0.951	negative regulation of biological process
GO:0051173	0.948	positive regulation of nitrogen compound metabolic process
GO:0010033	0.944	response to organic substance
GO:0002521	0.940	leukocyte differentiation
GO:0010628	0.938	positive regulation of gene expression
GO:0045892	0.935	negative regulation of DNA-templated transcription
GO:0030099	0.922	myeloid cell differentiation
GO:0051239	0.921	regulation of multicellular organismal process
GO:0002682	0.920	regulation of immune system process
GO:0045595	0.907	regulation of cell differentiation
GO:0045893	0.901	positive regulation of DNA-templated transcription
GO:0002376	0.862	immune system process
GO:0051716	0.849	cellular response to stimulus
GO:0002573	0.841	myeloid leukocyte differentiation
GO:0070887	0.829	cellular response to chemical stimulus
GO:0071310	0.799	cellular response to organic substance
GO:0065009	0.775	regulation of molecular function
GO:0048583	0.769	regulation of response to stimulus
GO:0007154	0.762	cell communication
GO:2000026	0.744	regulation of multicellular organismal development
GO:0023052	0.734	signaling
GO:1903706	0.725	regulation of hemopoiesis
GO:0007165	0.693	signal transduction
GO:0045944	0.693	positive regulation of transcription by RNA polymerase II
GO:0010629	0.691	negative regulation of gene expression
GO:0007275	0.684	multicellular organism development
GO:0006950	0.670	response to stress
GO:0000122	0.648	negative regulation of transcription by RNA polymerase II
GO:0007166	0.633	cell surface receptor signaling pathway
GO:0010646	0.615	regulation of cell communication
GO:0023051	0.610	regulation of signaling
GO:0009966	0.575	regulation of signal transduction
GO:0002684	0.573	positive regulation of immune system process
GO:0001775	0.562	cell activation
GO:0045321	0.539	leukocyte activation
GO:0071840	0.514	cellular component organization or biogenesis
GO:0051240	0.510	positive regulation of multicellular organismal process
GO:0016043	0.478	cellular component organization
GO:1902105	0.462	regulation of leukocyte differentiation
GO:0006955	0.461	immune response
GO:0008152	0.451	metabolic process
GO:0009607	0.436	response to biotic stimulus
GO:0034097	0.406	response to cytokine
GO:0071704	0.397	organic substance metabolic process
GO:0048731	0.396	system development
GO:0002252	0.384	immune effector process
GO:0045637	0.384	regulation of myeloid cell differentiation
GO:0009605	0.382	response to external stimulus
GO:0044419	0.379	biological process involved in interspecies interaction between organisms
GO:0044237	0.373	cellular metabolic process
GO:0048584	0.357	positive regulation of response to stimulus
GO:0048513	0.336	animal organ development
GO:0051094	0.329	positive regulation of developmental process
GO:0043170	0.324	macromolecule metabolic process
GO:0050865	0.301	regulation of cell activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.996	nuclear lumen
GO:0032991	0.994	protein-containing complex
GO:0005654	0.994	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005694	0.954	chromosome
GO:0000785	0.936	chromatin
GO:0005667	0.818	transcription regulator complex
GO:0005737	0.658	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]