StarFunc result for job id P17948

User Input

>input (1338 residues)
MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHK
WSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKET
ESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPD
GKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPV
KLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDK
MQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVK
AFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARC
DFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNK
VGTVGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTM
HYSISKQKMAITKEHSITLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRDQEA
PYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHKIQQEPGIILGPGSSTLFIER
VTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAATLFWLLLTLFI
RKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTK
QGGPLMVIVEYCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSV
TSSESFASSGFQEDKSLSDVEEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIH
RDLAARNILLSENNVVKICDFGLARDIYKNPDYVRKGDTRLPLKWMAPESIFDKIYSTKS
DVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMRAPEYSTPEIYQIMLDCWHRD
PKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFSEDFFKESISA
PKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIAC
CSPPPDYNSVVLYSTPPI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1RSU5	0.486	0.513	0.000	1251	0.814	0.871	F1RSU5.pdb.gz	F1RSU5_PIG Fms related receptor tyrosine kinase 1 OS=Sus scrofa OX=9823 GN=FLT1 PE=4 SV=5
2	AFDB:P17948	1.000	1.000	0.000	1338	1.000	1.000	P17948.pdb.gz	VGFR1_HUMAN Vascular endothelial growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FLT1 PE=1 SV=2
3	AFDB:P53767	0.793	0.794	0.000	1336	0.823	0.824	P53767.pdb.gz	VGFR1_RAT Vascular endothelial growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Flt1 PE=2 SV=1
4	AFDB:A0A0G2JW59	0.242	0.320	4.735E-56	1002	0.197	0.263	A0A0G2JW59.pdb.gz	A0A0G2JW59_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Flt3 PE=3 SV=2
5	AFDB:P36888	0.230	0.306	8.777E-56	993	0.195	0.263	P36888.pdb.gz	FLT3_HUMAN Receptor-type tyrosine-protein kinase FLT3 OS=Homo sapiens OX=9606 GN=FLT3 PE=1 SV=2
6	AFDB:E7F1P1	0.233	0.324	1.085E-50	956	0.186	0.260	E7F1P1.pdb.gz	E7F1P1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=flt3 PE=3 SV=1
7	AFDB:A4JYQ2	0.206	0.340	1.280E-49	802	0.191	0.319	A4JYQ2.pdb.gz
8	AFDB:E9PSY0	0.196	0.291	5.790E-43	888	0.144	0.217	E9PSY0.pdb.gz	E9PSY0_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
9	AFDB:E9PSX9	0.222	0.304	1.619E-42	879	0.139	0.212	E9PSX9.pdb.gz	E9PSX9_RAT receptor protein-tyrosine kinase OS=Rattus norvegicus OX=10116 GN=Axl PE=1 SV=2
10	AFDB:Q06418	0.206	0.303	1.989E-42	890	0.143	0.216	Q06418.pdb.gz	TYRO3_HUMAN Tyrosine-protein kinase receptor TYRO3 OS=Homo sapiens OX=9606 GN=TYRO3 PE=1 SV=1
11	PDB:5oj2B	0.105	0.186	2.847E-24	692	0.086	0.166	5oj2B.pdb.gz
12	PDB:1k9aB	0.183	0.537	5.400E-22	441	0.098	0.297	1k9aB.pdb.gz
13	PDB:1e07A	0.137	0.235	1.510E-21	642	0.071	0.148	1e07A.pdb.gz
14	PDB:2h8hA	0.184	0.521	6.448E-20	445	0.081	0.245	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
15	PDB:4fl2A	0.184	0.428	1.733E-18	555	0.072	0.173	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
16	PDB:4k2rA	0.183	0.431	1.162E-17	551	0.075	0.181	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
17	PDB:7sqcO0	0.119	0.127	2.542E-16	1140	0.061	0.071	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
18	PDB:6s73A	0.177	0.803	6.488E-15	269	0.051	0.253	6s73A.pdb.gz	Nek7 conformational flexibility and inhibitor binding probed through protein engineering of the R-spine.
19	PDB:2qkwB	0.167	0.695	2.499E-13	292	0.051	0.233	2qkwB.pdb.gz
20	PDB:7q5zA	0.096	0.096	3.582E-13	1344	0.052	0.051	7q5zA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DKP1	0.0	1239	1272	0.486	0.511	B3DKP1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=VEGFR1 PE=2 SV=1
2	E9PD35	0.0	943	1306	0.392	0.402	E9PD35_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=1
3	F1MWF1	0.0	1024	1356	0.445	0.440	F1MWF1_BOVIN receptor protein-tyrosine kinase OS=Bos taurus OX=9913 GN=KDR PE=3 SV=1
4	F1NW21	0.0	1055	1348	0.442	0.439	F1NW21_CHICK receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=KDR PE=3 SV=1
5	F1RSU5	0.0	681	362	0.237	0.876	F1RSU5_PIG Fms related receptor tyrosine kinase 1 OS=Sus scrofa OX=9823 GN=FLT1 PE=4 SV=5
6	L7RSL3	0.0	2793	1338	1.000	1.000	L7RSL3_HUMAN receptor protein-tyrosine kinase OS=Homo sapiens OX=9606 GN=FLT1 PE=3 SV=1
7	O08775	0.0	1013	1343	0.441	0.439	VGFR2_RAT Vascular endothelial growth factor receptor 2 OS=Rattus norvegicus OX=10116 GN=Kdr PE=1 SV=1
8	P17948	0.0	2793	1338	1.000	1.000	VGFR1_HUMAN Vascular endothelial growth factor receptor 1 OS=Homo sapiens OX=9606 GN=FLT1 PE=1 SV=2
9	P35916	0.0	942	1363	0.392	0.385	VGFR3_HUMAN Vascular endothelial growth factor receptor 3 OS=Homo sapiens OX=9606 GN=FLT4 PE=1 SV=3
10	P35917	0.0	941	1363	0.399	0.392	VGFR3_MOUSE Vascular endothelial growth factor receptor 3 OS=Mus musculus OX=10090 GN=Flt4 PE=1 SV=1
11	P35918	0.0	1013	1345	0.440	0.438	VGFR2_MOUSE Vascular endothelial growth factor receptor 2 OS=Mus musculus OX=10090 GN=Kdr PE=1 SV=2
12	P35968	0.0	1046	1356	0.451	0.445	VGFR2_HUMAN Vascular endothelial growth factor receptor 2 OS=Homo sapiens OX=9606 GN=KDR PE=1 SV=2
13	P35969	0.0	2274	1333	0.815	0.818	VGFR1_MOUSE Vascular endothelial growth factor receptor 1 OS=Mus musculus OX=10090 GN=Flt1 PE=1 SV=1
14	P53767	0.0	2295	1336	0.824	0.825	VGFR1_RAT Vascular endothelial growth factor receptor 1 OS=Rattus norvegicus OX=10116 GN=Flt1 PE=2 SV=1
15	Q5GIT4	0.0	952	1357	0.428	0.422	VGFR2_DANRE Vascular endothelial growth factor receptor 2 OS=Danio rerio OX=7955 GN=kdr PE=1 SV=2
16	Q5MD89	0.0	974	1357	0.416	0.410	VGFR3_DANRE Vascular endothelial growth factor receptor 3 OS=Danio rerio OX=7955 GN=flt4 PE=2 SV=1
17	Q677M1	0.0	1053	1348	0.442	0.439	Q677M1_CHICK receptor protein-tyrosine kinase OS=Gallus gallus OX=9031 GN=Flk1 PE=2 SV=1
18	Q8AXB3	0.0	1041	1302	0.443	0.455	VGFR4_DANRE Vascular endothelial growth factor receptor kdr-like OS=Danio rerio OX=7955 GN=kdrl PE=1 SV=1
19	Q91ZT1	0.0	938	1363	0.401	0.393	VGFR3_RAT Vascular endothelial growth factor receptor 3 OS=Rattus norvegicus OX=10116 GN=Flt4 PE=1 SV=1
20	F1QBD0	4.87e-144	448	473	0.161	0.455	F1QBD0_DANRE Platelet-derived growth factor receptor-like protein OS=Danio rerio OX=7955 GN=VEGFR1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	1.1e+02	14.0	Adenovirus E3 region protein CR1
2	PF07654 C1-set	1.8e-05	36.3	Immunoglobulin C1-set domain
3	PF05790 C2-set	0.91	21.1	Immunoglobulin C2-set domain
4	PF08205 C2-set_2	1.5	20.3	CD80-like C2-set immunoglobulin domain
5	PF12330 Haspin_kinase	72	13.8	Haspin like kinase domain
6	PF02480 Herpes_gE	59	14.5	Alphaherpesvirus glycoprotein E
7	PF07679 I-set	2.6e-55	195.8	Immunoglobulin I-set domain
8	PF00047 ig	3.9e-40	147.3	Immunoglobulin domain
9	PF13895 Ig_2	1.7e-38	142.1	Immunoglobulin domain
10	PF13927 Ig_3	1.3e-58	206.8	Immunoglobulin domain
11	PF16680 Ig_4	4.8e-06	38.4	T-cell surface glycoprotein CD3 delta chain
12	PF16681 Ig_5	0.01	27.6	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
13	PF18452 Ig_6	0.00044	31.5	Immunoglobulin domain
14	PF17736 Ig_C17orf99	35	15.9	C17orf99 Ig domain
15	PF16706 Izumo-Ig	0.03	25.6	Izumo-like Immunoglobulin domain
16	PF02124 Marek_A	11	17.8	Marek's disease glycoprotein A
17	PF00069 Pkinase	5.3e-41	152.3	Protein kinase domain
18	PF07714 PK_Tyr_Ser-Thr	8e-101	348.3	Protein tyrosine and serine/threonine kinase
19	PF07686 V-set	3.8e-22	89.9	Immunoglobulin V-set domain
20	PF17988 VEGFR-2_TMD	1.7e-14	64.3	VEGFR-2 Transmembrane domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000282397

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265371	0.999	Neuropilin-1
2	9606.ENSP00000311127	0.999	Vascular endothelial growth factor B
3	9606.ENSP00000451040	0.999	Placenta growth factor
4	9606.ENSP00000478570	0.999	Vascular endothelial growth factor A
5	9606.ENSP00000263923	0.998	Vascular endothelial growth factor receptor 2
6	9606.ENSP00000340944	0.990	Tyrosine-protein phosphatase non-receptor type 11
7	9606.ENSP00000353582	0.990	Neuropilin-2
8	9606.ENSP00000244007	0.987	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
9	9606.ENSP00000480043	0.987	Vascular endothelial growth factor C
10	9606.ENSP00000428056	0.985	Phosphatidylinositol 3-kinase regulatory subunit alpha
11	9606.ENSP00000261937	0.984	Vascular endothelial growth factor receptor 3
12	9606.ENSP00000264033	0.984	E3 ubiquitin-protein ligase CBL
13	9606.ENSP00000264554	0.979	SHC-transforming protein 2
14	9606.ENSP00000341189	0.974	Focal adhesion kinase 1
15	9606.ENSP00000417273	0.972	Cytoplasmic protein NCK1
16	9606.ENSP00000297904	0.968	Vascular endothelial growth factor D
17	9606.ENSP00000376345	0.965	Growth factor receptor-bound protein 2
18	9606.ENSP00000263967	0.959	Phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
19	9606.ENSP00000401303	0.959	SHC-transforming protein 1
20	9606.ENSP00000262186	0.949	Potassium voltage-gated channel subfamily H member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019838	1.000	growth factor binding
GO:0004714	1.000	transmembrane receptor protein tyrosine kinase activity
GO:0005021	0.850	vascular endothelial growth factor receptor activity
GO:0042802	0.699	identical protein binding
GO:0019899	0.525	enzyme binding
GO:0005102	0.454	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.971	regulation of cellular process
GO:0051716	0.969	cellular response to stimulus
GO:0007154	0.967	cell communication
GO:0023052	0.966	signaling
GO:0007165	0.960	signal transduction
GO:0048522	0.958	positive regulation of cellular process
GO:0019222	0.948	regulation of metabolic process
GO:0007166	0.944	cell surface receptor signaling pathway
GO:0007167	0.931	enzyme-linked receptor protein signaling pathway
GO:0060255	0.916	regulation of macromolecule metabolic process
GO:0032502	0.915	developmental process
GO:0031323	0.911	regulation of cellular metabolic process
GO:0050793	0.899	regulation of developmental process
GO:0007169	0.899	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0032501	0.898	multicellular organismal process
GO:0008152	0.893	metabolic process
GO:0042127	0.892	regulation of cell population proliferation
GO:0009893	0.890	positive regulation of metabolic process
GO:0071704	0.882	organic substance metabolic process
GO:0051239	0.862	regulation of multicellular organismal process
GO:0042327	0.859	positive regulation of phosphorylation
GO:0043410	0.859	positive regulation of MAPK cascade
GO:0048856	0.858	anatomical structure development
GO:0030335	0.845	positive regulation of cell migration
GO:0044237	0.842	cellular metabolic process
GO:0001934	0.835	positive regulation of protein phosphorylation
GO:0071363	0.828	cellular response to growth factor stimulus
GO:0045765	0.820	regulation of angiogenesis
GO:0051347	0.811	positive regulation of transferase activity
GO:0044238	0.799	primary metabolic process
GO:0051094	0.796	positive regulation of developmental process
GO:0016477	0.787	cell migration
GO:0042221	0.776	response to chemical
GO:0014066	0.773	regulation of phosphatidylinositol 3-kinase signaling
GO:0006793	0.765	phosphorus metabolic process
GO:0048523	0.758	negative regulation of cellular process
GO:0043549	0.756	regulation of kinase activity
GO:0006807	0.749	nitrogen compound metabolic process
GO:0009605	0.739	response to external stimulus
GO:0007275	0.733	multicellular organism development
GO:0008284	0.732	positive regulation of cell population proliferation
GO:0051336	0.701	regulation of hydrolase activity
GO:0033674	0.692	positive regulation of kinase activity
GO:0006935	0.690	chemotaxis
GO:0018108	0.662	peptidyl-tyrosine phosphorylation
GO:0048731	0.658	system development
GO:0070887	0.656	cellular response to chemical stimulus
GO:0048010	0.656	vascular endothelial growth factor receptor signaling pathway
GO:0051240	0.655	positive regulation of multicellular organismal process
GO:0045859	0.643	regulation of protein kinase activity
GO:0014068	0.618	positive regulation of phosphatidylinositol 3-kinase signaling
GO:1904018	0.574	positive regulation of vasculature development
GO:0009653	0.567	anatomical structure morphogenesis
GO:0002376	0.492	immune system process
GO:0010468	0.488	regulation of gene expression
GO:0043550	0.488	regulation of lipid kinase activity
GO:0043551	0.462	regulation of phosphatidylinositol 3-kinase activity
GO:0010517	0.447	regulation of phospholipase activity
GO:0006950	0.436	response to stress
GO:0048513	0.359	animal organ development
GO:0010941	0.304	regulation of cell death
GO:0071840	0.301	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043229	0.998	intracellular organelle
GO:0005576	0.988	extracellular region
GO:0043227	0.971	membrane-bounded organelle
GO:0005737	0.967	cytoplasm
GO:0043231	0.957	intracellular membrane-bounded organelle
GO:0005615	0.954	extracellular space
GO:0043228	0.853	non-membrane-bounded organelle
GO:0043232	0.819	intracellular non-membrane-bounded organelle
GO:0005634	0.767	nucleus
GO:0015629	0.539	actin cytoskeleton
GO:0032991	0.489	protein-containing complex
GO:0070013	0.358	intracellular organelle lumen
GO:0031982	0.336	vesicle
GO:0031981	0.303	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.10.1	1.000	receptor protein-tyrosine kinase.

[back to server]