StarFunc result for job id P17980

User Input

>input (439 residues)
MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVL
RVTHELQAMKDKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGK
CAVIKTSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDER
PTEQYSDIGGLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARAC
AAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEK
AGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEE
ARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY
MEGILEVQAKKKANLQYYA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O88685	0.913	0.907	7.644E-76	442	0.993	0.986	O88685.pdb.gz	PRS6A_MOUSE 26S proteasome regulatory subunit 6A OS=Mus musculus OX=10090 GN=Psmc3 PE=1 SV=2
2	AFDB:O76371	0.907	0.925	3.680E-70	430	0.774	0.791	O76371.pdb.gz	PRS6A_CAEEL 26S protease regulatory subunit 6A OS=Caenorhabditis elegans OX=6239 GN=rpt-5 PE=1 SV=1
3	AFDB:Q9XZC3	0.896	0.912	9.555E-69	431	0.797	0.812	Q9XZC3.pdb.gz	Q9XZC3_DROME Tat-binding protein-1 OS=Drosophila melanogaster OX=7227 GN=Rpt5 PE=1 SV=1
4	AFDB:Q9SEI2	0.891	0.921	1.544E-66	424	0.736	0.762	Q9SEI2.pdb.gz	PS6AA_ARATH 26S proteasome regulatory subunit 6A homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT5A PE=1 SV=1
5	PDB:5l4gM	0.844	0.890	1.282E-64	415	0.943	0.998	5l4gM.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
6	AFDB:Q54PN7	0.895	0.932	1.741E-63	421	0.661	0.689	Q54PN7.pdb.gz	PRS6A_DICDI 26S proteasome regulatory subunit 6A homolog OS=Dictyostelium discoideum OX=44689 GN=psmC3 PE=1 SV=1
7	AFDB:O14126	0.882	0.884	3.660E-63	438	0.681	0.683	O14126.pdb.gz	PRS6A_SCHPO 26S proteasome regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tbp1 PE=3 SV=1
8	AFDB:P33297	0.891	0.901	5.156E-63	434	0.661	0.668	P33297.pdb.gz	PRS6A_YEAST 26S proteasome regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT5 PE=1 SV=3
9	PDB:6msgF	0.751	0.826	4.234E-57	395	0.895	0.995	6msgF.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
10	PDB:6fvtM	0.824	0.857	7.288E-52	421	0.658	0.686	6fvtM.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.
11	PDB:5mp9M	0.781	0.894	2.246E-50	381	0.638	0.735	5mp9M.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
12	AFDB:Q94BQ2	0.735	0.769	8.728E-47	419	0.387	0.406	Q94BQ2.pdb.gz	PRS8B_ARATH 26S proteasome regulatory subunit 8 homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT6B PE=1 SV=1
13	AFDB:P41836	0.731	0.795	1.097E-46	403	0.390	0.424	P41836.pdb.gz	PRS8_SCHPO 26S proteasome regulatory subunit 8 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=let1 PE=3 SV=1
14	AFDB:Q58576	0.755	0.770	3.068E-46	430	0.428	0.437	Q58576.pdb.gz	PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=pan PE=1 SV=1
15	PDB:3jcoM	0.652	0.789	9.375E-40	357	0.592	0.728	3jcoM.pdb.gz
16	PDB:5l4gL	0.700	0.786	2.135E-37	389	0.353	0.398	5l4gL.pdb.gz	Structure of the human 26S proteasome at a resolution of 3.9 angstrom.
17	PDB:5mp9I	0.652	0.734	2.393E-37	385	0.378	0.431	5mp9I.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
18	PDB:6msjB	0.694	0.740	2.841E-37	411	0.387	0.414	6msjB.pdb.gz	Cryo-EM structures and dynamics of substrate-engaged human 26S proteasome.
19	PDB:5mp9L	0.700	0.787	1.614E-34	388	0.333	0.376	5mp9L.pdb.gz	Structural insights into the functional cycle of the ATPase module of the 26S proteasome.
20	PDB:6fvtK	0.672	0.741	1.708E-34	394	0.335	0.373	6fvtK.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O04019	0.0	665	423	0.724	0.752	PS6AB_ARATH 26S proteasome regulatory subunit 6A homolog B OS=Arabidopsis thaliana OX=3702 GN=RPT5B PE=1 SV=3
2	O14126	0.0	619	438	0.677	0.678	PRS6A_SCHPO 26S proteasome regulatory subunit 6A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tbp1 PE=3 SV=1
3	O76371	0.0	709	430	0.774	0.791	PRS6A_CAEEL 26S protease regulatory subunit 6A OS=Caenorhabditis elegans OX=6239 GN=rpt-5 PE=1 SV=1
4	O88685	0.0	893	442	0.993	0.986	PRS6A_MOUSE 26S proteasome regulatory subunit 6A OS=Mus musculus OX=10090 GN=Psmc3 PE=1 SV=2
5	P17980	0.0	899	439	1.000	1.000	PRS6A_HUMAN 26S proteasome regulatory subunit 6A OS=Homo sapiens OX=9606 GN=PSMC3 PE=1 SV=3
6	P33297	0.0	617	434	0.663	0.671	PRS6A_YEAST 26S proteasome regulatory subunit 6A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPT5 PE=1 SV=3
7	Q54PN7	0.0	610	421	0.672	0.701	PRS6A_DICDI 26S proteasome regulatory subunit 6A homolog OS=Dictyostelium discoideum OX=44689 GN=psmC3 PE=1 SV=1
8	Q63569	0.0	893	439	0.993	0.993	PRS6A_RAT 26S proteasome regulatory subunit 6A OS=Rattus norvegicus OX=10116 GN=Psmc3 PE=1 SV=1
9	Q9SEI2	0.0	674	424	0.743	0.769	PS6AA_ARATH 26S proteasome regulatory subunit 6A homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT5A PE=1 SV=1
10	Q9V3V6	0.0	752	428	0.813	0.834	Q9V3V6_DROME 26S proteasome regulatory complex subunit p50 OS=Drosophila melanogaster OX=7227 GN=Rpt5 PE=1 SV=1
11	Q9XZC3	0.0	736	431	0.797	0.812	Q9XZC3_DROME Tat-binding protein-1 OS=Drosophila melanogaster OX=7227 GN=Rpt5 PE=1 SV=1
12	P48601	5.98e-117	351	439	0.394	0.394	PRS4_DROME 26S proteasome regulatory subunit 4 OS=Drosophila melanogaster OX=7227 GN=Rpt2 PE=1 SV=2
13	P62191	3.69e-116	348	440	0.390	0.389	PRS4_HUMAN 26S proteasome regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
14	P62192	3.69e-116	348	440	0.390	0.389	PRS4_MOUSE 26S proteasome regulatory subunit 4 OS=Mus musculus OX=10090 GN=Psmc1 PE=1 SV=1
15	P62193	3.69e-116	348	440	0.390	0.389	PRS4_RAT 26S proteasome regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Psmc1 PE=1 SV=1
16	Q53XL8	3.69e-116	348	440	0.390	0.389	Q53XL8_HUMAN Proteasome (Prosome, macropain) 26S subunit, ATPase, 1 OS=Homo sapiens OX=9606 GN=PSMC1 PE=1 SV=1
17	Q53HB3	4.25e-116	348	440	0.390	0.389	Q53HB3_HUMAN Proteasome 26S ATPase subunit 1 variant (Fragment) OS=Homo sapiens OX=9606 PE=1 SV=1
18	Q58576	2.51e-115	346	430	0.380	0.388	PAN_METJA Proteasome-activating nucleotidase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=pan PE=1 SV=1
19	Q9SZD4	2.17e-114	344	443	0.392	0.388	PRS4A_ARATH 26S proteasome regulatory subunit 4 homolog A OS=Arabidopsis thaliana OX=3702 GN=RPT2A PE=1 SV=1
20	Q55BV5	3.47e-114	343	439	0.367	0.367	PRS4_DICDI 26S proteasome regulatory subunit 4 homolog OS=Dictyostelium discoideum OX=44689 GN=psmC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.2e-38	143.1	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	23	16.2	AAA domain
3	PF13191 AAA_16	0.078	24.8	AAA ATPase domain
4	PF07724 AAA_2	0.67	21.6	AAA domain (Cdc48 subfamily)
5	PF13401 AAA_22	2.3	20.0	AAA domain
6	PF13479 AAA_24	1.3e+02	13.7	AAA domain
7	PF13481 AAA_25	1.1e+02	13.8	AAA domain
8	PF13671 AAA_33	9.1	17.9	AAA domain
9	PF07728 AAA_5	0.013	27.0	AAA domain (dynein-related subfamily)
10	PF12775 AAA_7	1.9e+02	13.0	P-loop containing dynein motor region
11	PF17862 AAA_lid_3	7.2e-07	40.3	AAA+ lid domain
12	PF06745 ATPase	1.4e+02	13.3	KaiC
13	PF12506 DUF3713	3.1e+02	13.1	Protein of unknown function (DUF3713)
14	PF19145 DUF5827	92	14.6	Family of unknown function (DUF5827)
15	PF05673 DUF815	27	15.3	Protein of unknown function (DUF815)
16	PF01695 IstB_IS21	1.1e+02	13.7	IstB-like ATP binding protein
17	PF01078 Mg_chelatase	21	16.0	Magnesium chelatase, subunit ChlI
18	PF02562 PhoH	44	15.0	PhoH-like protein
19	PF16450 Prot_ATP_ID_OB	3.8e-14	63.7	Proteasomal ATPase OB C-terminal domain
20	PF17758 Prot_ATP_OB_N	2.8e+02	12.7	Proteasomal ATPase OB N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000481029

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000044462	0.999	Proteasome subunit alpha type-4
2	9606.ENSP00000157812	0.999	26S proteasome regulatory subunit 6B
3	9606.ENSP00000215071	0.999	26S proteasome non-ATPase regulatory subunit 8
4	9606.ENSP00000216455	0.999	Proteasome subunit alpha type-3
5	9606.ENSP00000219313	0.999	26S proteasome non-ATPase regulatory subunit 7
6	9606.ENSP00000223321	0.999	Proteasome subunit alpha type-2
7	9606.ENSP00000259457	0.999	Proteasome subunit beta type-7
8	9606.ENSP00000261303	0.999	26S proteasome regulatory subunit 4
9	9606.ENSP00000261479	0.999	Proteasome subunit alpha type-6
10	9606.ENSP00000261601	0.999	Ubiquitin carboxyl-terminal hydrolase 14
11	9606.ENSP00000261712	0.999	26S proteasome non-ATPase regulatory subunit 11
12	9606.ENSP00000262193	0.999	Proteasome subunit beta type-1
13	9606.ENSP00000264639	0.999	26S proteasome non-ATPase regulatory subunit 3
14	9606.ENSP00000270586	0.999	Proteasome subunit beta type-6
15	9606.ENSP00000271308	0.999	Proteasome subunit alpha type-5
16	9606.ENSP00000290541	0.999	Proteasome subunit beta type-4
17	9606.ENSP00000309474	0.999	26S proteasome non-ATPase regulatory subunit 1
18	9606.ENSP00000310129	0.999	26S proteasome non-ATPase regulatory subunit 2
19	9606.ENSP00000310572	0.999	26S proteasome regulatory subunit 8
20	9606.ENSP00000348442	0.999	26S proteasome non-ATPase regulatory subunit 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.907	ATP-dependent activity
GO:0003824	0.657	catalytic activity
GO:0042802	0.387	identical protein binding
GO:1901363	0.370	heterocyclic compound binding
GO:0097159	0.367	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.946	organic substance metabolic process
GO:0044238	0.943	primary metabolic process
GO:0009987	0.930	cellular process
GO:0006807	0.902	nitrogen compound metabolic process
GO:0065007	0.872	biological regulation
GO:0050789	0.850	regulation of biological process
GO:0043170	0.813	macromolecule metabolic process
GO:1901564	0.798	organonitrogen compound metabolic process
GO:0032501	0.791	multicellular organismal process
GO:0032502	0.773	developmental process
GO:0001701	0.737	in utero embryonic development
GO:0019538	0.729	protein metabolic process
GO:0050794	0.724	regulation of cellular process
GO:0019222	0.685	regulation of metabolic process
GO:0001824	0.655	blastocyst development
GO:0060255	0.591	regulation of macromolecule metabolic process
GO:0080090	0.585	regulation of primary metabolic process
GO:0044237	0.555	cellular metabolic process
GO:0051171	0.550	regulation of nitrogen compound metabolic process
GO:0050896	0.545	response to stimulus
GO:0044260	0.487	cellular macromolecule metabolic process
GO:0048518	0.475	positive regulation of biological process
GO:0031323	0.471	regulation of cellular metabolic process
GO:0010604	0.435	positive regulation of macromolecule metabolic process
GO:0048522	0.403	positive regulation of cellular process
GO:0006508	0.403	proteolysis
GO:0030163	0.363	protein catabolic process
GO:0010468	0.333	regulation of gene expression
GO:0031326	0.333	regulation of cellular biosynthetic process
GO:0019219	0.329	regulation of nucleobase-containing compound metabolic process
GO:0010556	0.328	regulation of macromolecule biosynthetic process
GO:0051246	0.327	regulation of protein metabolic process
GO:0051173	0.327	positive regulation of nitrogen compound metabolic process
GO:0051603	0.309	proteolysis involved in protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	1.000	intracellular organelle
GO:1902494	0.998	catalytic complex
GO:0140535	0.998	intracellular protein-containing complex
GO:0005829	0.997	cytosol
GO:0000502	0.993	proteasome complex
GO:0005634	0.992	nucleus
GO:0070013	0.888	intracellular organelle lumen
GO:0031981	0.876	nuclear lumen
GO:0043232	0.861	intracellular non-membrane-bounded organelle
GO:0005654	0.861	nucleoplasm
GO:0005576	0.796	extracellular region
GO:0031982	0.684	vesicle
GO:0016020	0.388	membrane
GO:0012505	0.386	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]