StarFunc result for job id P18031

User Input

>input (435 residues)
MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHEDLE
PPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEKGSPLNAAPYG
IESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT
AGAYLCYRFLFNSNT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K3M3	0.704	0.704	1.895E-77	435	1.000	1.000	A8K3M3.pdb.gz	A8K3M3_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN1 PE=2 SV=1
2	AFDB:P20417	0.703	0.708	7.148E-70	432	0.846	0.852	P20417.pdb.gz	PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus OX=10116 GN=Ptpn1 PE=1 SV=1
3	AFDB:O13016	0.712	0.713	8.784E-67	434	0.779	0.781	O13016.pdb.gz	PTN1_CHICK Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus OX=9031 GN=PTPN1 PE=1 SV=1
4	AFDB:P17706	0.690	0.723	2.298E-52	415	0.529	0.554	P17706.pdb.gz	PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=2
5	AFDB:P35233	0.683	0.714	1.323E-51	416	0.517	0.541	P35233.pdb.gz	PTN2_RAT Tyrosine-protein phosphatase non-receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ptpn2 PE=1 SV=2
6	AFDB:Q9W0G1	0.659	0.527	1.213E-35	548	0.395	0.314	Q9W0G1.pdb.gz	PTP61_DROME Tyrosine-protein phosphatase non-receptor type 61F OS=Drosophila melanogaster OX=7227 GN=Ptp61F PE=1 SV=1
7	AFDB:E7F716	0.574	0.442	6.880E-27	571	0.248	0.189	E7F716.pdb.gz	E7F716_DANRE Protein tyrosine phosphatase non-receptor type 9a OS=Danio rerio OX=7955 GN=ptpn9a PE=1 SV=1
8	AFDB:E9Q0N2	0.597	0.272	9.124E-27	971	0.234	0.105	E9Q0N2.pdb.gz	PTPRH_MOUSE Receptor-type tyrosine-protein phosphatase H OS=Mus musculus OX=10090 GN=Ptprh PE=1 SV=1
9	AFDB:Q95Y26	0.600	0.557	9.654E-27	469	0.241	0.224	Q95Y26.pdb.gz	Q95Y26_CAEEL Protein-tyrosine-phosphatase OS=Caenorhabditis elegans OX=6239 GN=ptpn-22 PE=1 SV=2
10	PDB:5xzrA	0.533	0.449	1.156E-26	519	0.239	0.200	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
11	AFDB:B6HY54	0.602	0.166	1.796E-26	1650	0.248	0.065	B6HY54.pdb.gz	B6HY54_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=dep1a PE=2 SV=1
12	PDB:3ps5A	0.559	0.463	7.451E-26	529	0.223	0.183	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
13	PDB:4gwfA	0.584	0.514	8.342E-26	497	0.232	0.203	4gwfA.pdb.gz
14	PDB:6krwA	0.579	0.812	3.831E-25	306	0.221	0.314	6krwA.pdb.gz
15	PDB:3m4uA	0.536	0.794	8.695E-18	285	0.172	0.263	3m4uA.pdb.gz
16	PDB:3s4oA	0.266	0.617	1.431E-4	163	0.078	0.209	3s4oA.pdb.gz
17	PDB:2gwoC	0.231	0.501	8.712E-4	174	0.064	0.161	2gwoC.pdb.gz
18	PDB:4ercA	0.269	0.687	1.032E-3	150	0.080	0.233	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
19	PDB:5bx1A	0.245	0.608	3.017E-3	153	0.071	0.203	5bx1A.pdb.gz	Crystal Structure of PRL-1 complex with compound analogy 3
20	PDB:5xjvB	0.240	0.534	3.378E-3	171	0.048	0.123	5xjvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K3M3	0.0	912	435	1.000	1.000	A8K3M3_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN1 PE=2 SV=1
2	B4DSN5	0.0	759	362	0.832	1.000	B4DSN5_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1
3	O13016	0.0	668	434	0.779	0.781	PTN1_CHICK Tyrosine-protein phosphatase non-receptor type 1 OS=Gallus gallus OX=9031 GN=PTPN1 PE=1 SV=1
4	P18031	0.0	912	435	1.000	1.000	PTN1_HUMAN Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1
5	P20417	0.0	739	432	0.846	0.852	PTN1_RAT Tyrosine-protein phosphatase non-receptor type 1 OS=Rattus norvegicus OX=10116 GN=Ptpn1 PE=1 SV=1
6	P35821	0.0	721	432	0.828	0.833	PTN1_MOUSE Tyrosine-protein phosphatase non-receptor type 1 OS=Mus musculus OX=10090 GN=Ptpn1 PE=1 SV=2
7	P17706	2.17e-165	473	415	0.543	0.569	PTN2_HUMAN Tyrosine-protein phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=2
8	P35233	1.75e-162	466	416	0.531	0.555	PTN2_RAT Tyrosine-protein phosphatase non-receptor type 2 OS=Rattus norvegicus OX=10116 GN=Ptpn2 PE=1 SV=2
9	Q06180	1.87e-161	462	406	0.529	0.567	PTN2_MOUSE Tyrosine-protein phosphatase non-receptor type 2 OS=Mus musculus OX=10090 GN=Ptpn2 PE=1 SV=2
10	A8K3N4	1.15e-160	460	387	0.490	0.550	A8K3N4_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTN2 PE=2 SV=1
11	K7EQG9	1.72e-140	409	386	0.478	0.539	K7EQG9_HUMAN Tyrosine-protein phosphatase non-receptor type OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=1
12	D3DUJ3	1.40e-111	332	316	0.398	0.547	D3DUJ3_HUMAN Protein tyrosine phosphatase non-receptor type 2 OS=Homo sapiens OX=9606 GN=PTPN2 PE=1 SV=1
13	Q9W0G1	3.92e-95	298	548	0.340	0.270	PTP61_DROME Tyrosine-protein phosphatase non-receptor type 61F OS=Drosophila melanogaster OX=7227 GN=Ptp61F PE=1 SV=1
14	Q8IRM6	2.01e-63	214	498	0.264	0.231	Q8IRM6_DROME Protein tyrosine phosphatase Meg2, isoform D OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
15	Q59E68	2.02e-62	214	597	0.264	0.193	Q59E68_DROME Protein tyrosine phosphatase Meg2, isoform F OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
16	Q8IRM7	3.83e-61	214	797	0.264	0.144	Q8IRM7_DROME LD30065p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
17	M9MS42	4.11e-61	214	790	0.264	0.146	M9MS42_DROME Protein tyrosine phosphatase Meg2, isoform G OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=1
18	Q9W324	4.76e-61	214	802	0.264	0.143	Q9W324_DROME LP18470p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=2
19	Q9W323	6.56e-61	214	827	0.264	0.139	Q9W323_DROME LD27988p OS=Drosophila melanogaster OX=7227 GN=Ptpmeg2 PE=1 SV=2
20	P23467	3.58e-56	202	1997	0.241	0.053	PTPRB_HUMAN Receptor-type tyrosine-protein phosphatase beta OS=Homo sapiens OX=9606 GN=PTPRB PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	0.11	23.8	Dual specificity phosphatase, catalytic domain
2	PF14566 PTPlike_phytase	5.1e+02	12.2	Inositol hexakisphosphate
3	PF00102 Y_phosphatase	3.5e-76	267.4	Protein-tyrosine phosphatase
4	PF13350 Y_phosphatase3	20	16.6	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360683

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
2	9606.ENSP00000303830	0.999	Insulin receptor
3	9606.ENSP00000376345	0.999	Growth factor receptor-bound protein 2
4	9606.ENSP00000268035	0.998	Insulin-like growth factor 1 receptor
5	9606.ENSP00000269141	0.998	Cadherin-2
6	9606.ENSP00000362680	0.997	Proto-oncogene tyrosine-protein kinase Src
7	9606.ENSP00000371067	0.997	Tyrosine-protein kinase JAK2
8	9606.ENSP00000391669	0.994	Breast cancer anti-estrogen resistance protein 1
9	9606.ENSP00000260385	0.992	Regulator of microtubule dynamics protein 3
10	9606.ENSP00000304895	0.988	Insulin receptor substrate 1
11	9606.ENSP00000344456	0.988	Catenin beta-1
12	9606.ENSP00000352358	0.986	Transient receptor potential cation channel subfamily V member 6
13	9606.ENSP00000317272	0.981	Hepatocyte growth factor receptor
14	9606.ENSP00000343204	0.980	Tyrosine-protein kinase JAK1
15	9606.ENSP00000261799	0.975	Platelet-derived growth factor receptor beta
16	9606.ENSP00000451828	0.975	RAC-alpha serine/threonine-protein kinase
17	9606.ENSP00000339191	0.974	Caveolin-1
18	9606.ENSP00000380432	0.974	Insulin
19	9606.ENSP00000330393	0.973	Leptin receptor
20	9606.ENSP00000293328	0.971	Signal transducer and activator of transcription 5B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004725	0.999	protein tyrosine phosphatase activity
GO:0019899	0.752	enzyme binding
GO:0005102	0.730	signaling receptor binding
GO:0044877	0.474	protein-containing complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0019538	0.987	protein metabolic process
GO:0043412	0.986	macromolecule modification
GO:0050896	0.985	response to stimulus
GO:0019222	0.984	regulation of metabolic process
GO:0023052	0.981	signaling
GO:0048583	0.978	regulation of response to stimulus
GO:0048518	0.978	positive regulation of biological process
GO:0007154	0.977	cell communication
GO:0051716	0.977	cellular response to stimulus
GO:0006796	0.975	phosphate-containing compound metabolic process
GO:0036211	0.975	protein modification process
GO:0060255	0.974	regulation of macromolecule metabolic process
GO:0048522	0.974	positive regulation of cellular process
GO:0009966	0.970	regulation of signal transduction
GO:0080090	0.967	regulation of primary metabolic process
GO:0031323	0.967	regulation of cellular metabolic process
GO:0007165	0.964	signal transduction
GO:0080135	0.961	regulation of cellular response to stress
GO:0006470	0.960	protein dephosphorylation
GO:0045859	0.956	regulation of protein kinase activity
GO:0048519	0.938	negative regulation of biological process
GO:1905897	0.938	regulation of response to endoplasmic reticulum stress
GO:0071900	0.933	regulation of protein serine/threonine kinase activity
GO:0048523	0.931	negative regulation of cellular process
GO:0043408	0.925	regulation of MAPK cascade
GO:0043405	0.920	regulation of MAP kinase activity
GO:0007169	0.898	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0051248	0.895	negative regulation of protein metabolic process
GO:0031400	0.875	negative regulation of protein modification process
GO:0045860	0.866	positive regulation of protein kinase activity
GO:0048585	0.865	negative regulation of response to stimulus
GO:0045936	0.864	negative regulation of phosphate metabolic process
GO:0035335	0.842	peptidyl-tyrosine dephosphorylation
GO:0001933	0.841	negative regulation of protein phosphorylation
GO:0044092	0.836	negative regulation of molecular function
GO:0048584	0.829	positive regulation of response to stimulus
GO:0043086	0.819	negative regulation of catalytic activity
GO:0043409	0.805	negative regulation of MAPK cascade
GO:0051348	0.802	negative regulation of transferase activity
GO:0010243	0.798	response to organonitrogen compound
GO:0006469	0.792	negative regulation of protein kinase activity
GO:0070887	0.760	cellular response to chemical stimulus
GO:0071495	0.750	cellular response to endogenous stimulus
GO:0006950	0.743	response to stress
GO:0009967	0.740	positive regulation of signal transduction
GO:0071310	0.731	cellular response to organic substance
GO:1901701	0.716	cellular response to oxygen-containing compound
GO:0033554	0.683	cellular response to stress
GO:1900101	0.674	regulation of endoplasmic reticulum unfolded protein response
GO:1903573	0.669	negative regulation of response to endoplasmic reticulum stress
GO:1901652	0.642	response to peptide
GO:0046626	0.407	regulation of insulin receptor signaling pathway
GO:0071840	0.312	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.991	endomembrane system
GO:0005829	0.952	cytosol
GO:0071944	0.884	cell periphery
GO:0031982	0.879	vesicle
GO:0016020	0.875	membrane
GO:0005886	0.864	plasma membrane
GO:0005783	0.862	endoplasmic reticulum
GO:0043233	0.826	organelle lumen
GO:0070013	0.820	intracellular organelle lumen
GO:0097708	0.553	intracellular vesicle
GO:0031410	0.518	cytoplasmic vesicle
GO:0005634	0.305	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	0.999	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	0.999	protein-tyrosine-phosphatase.

[back to server]