StarFunc result for job id P18065

User Input

>input (325 residues)
MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAP
PAAVAAVAGGARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELP
LQALVMGEGTCEKRRDAEYGASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKP
LKSGMKELAVFREKVTEQHRQMGKGGKHHLGLEEPKKLRPPPARTPCQQELDQVLERIST
MRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQRGECWCVNPNTGKLIQGAPTI
RGDPECHLFYNEQQEARGVHTQRMQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18065	1.000	1.000	4.080E-64	325	1.000	1.000	P18065.pdb.gz	IBP2_HUMAN Insulin-like growth factor-binding protein 2 OS=Homo sapiens OX=9606 GN=IGFBP2 PE=1 SV=2
2	AFDB:P13384	0.371	0.380	7.850E-52	317	0.874	0.896	P13384.pdb.gz	IBP2_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus OX=9913 GN=IGFBP2 PE=1 SV=2
3	AFDB:P47877	0.473	0.499	7.858E-50	305	0.825	0.879	P47877.pdb.gz	IBP2_MOUSE Insulin-like growth factor-binding protein 2 OS=Mus musculus OX=10090 GN=Igfbp2 PE=2 SV=2
4	AFDB:B3F211	0.305	0.367	9.335E-29	265	0.394	0.483	B3F211.pdb.gz	IBP2B_DANRE Insulin-like growth factor-binding protein 2-B OS=Danio rerio OX=7955 GN=igfbp2b PE=1 SV=1
5	AFDB:Q9PTH3	0.290	0.337	3.646E-28	276	0.440	0.518	Q9PTH3.pdb.gz	IBP2A_DANRE Insulin-like growth factor-binding protein 2-A OS=Danio rerio OX=7955 GN=igfbp2a PE=1 SV=1
6	AFDB:G1NGG4	0.324	0.506	1.474E-22	202	0.422	0.678	G1NGG4.pdb.gz	G1NGG4_MELGA Thyroglobulin type-1 domain-containing protein OS=Meleagris gallopavo OX=9103 GN=IGFBP2 PE=4 SV=2
7	AFDB:P17936	0.267	0.297	4.442E-22	291	0.295	0.330	P17936.pdb.gz	IBP3_HUMAN Insulin-like growth factor-binding protein 3 OS=Homo sapiens OX=9606 GN=IGFBP3 PE=1 SV=2
8	AFDB:P08833	0.265	0.324	5.758E-22	259	0.283	0.355	P08833.pdb.gz	IBP1_HUMAN Insulin-like growth factor-binding protein 1 OS=Homo sapiens OX=9606 GN=IGFBP1 PE=1 SV=1
9	AFDB:P21743	0.292	0.339	5.758E-22	272	0.298	0.357	P21743.pdb.gz	IBP1_RAT Insulin-like growth factor-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igfbp1 PE=1 SV=2
10	AFDB:P22692	0.290	0.358	6.995E-22	258	0.320	0.403	P22692.pdb.gz	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
11	PDB:7wrqB	0.230	0.432	2.239E-11	167	0.234	0.455	7wrqB.pdb.gz
12	PDB:5irxF	0.083	0.306	7.716E-1	75	0.046	0.200	5irxF.pdb.gz	TRPV1 structures in nanodiscs reveal mechanisms of ligand and lipid action.
13	PDB:7myjC	0.098	0.075	1.067	465	0.062	0.043	7myjC.pdb.gz	Structure-function analysis of the AMPK activator SC4 and identification of a potent pan AMPK activator.
14	PDB:7d63RQ	0.068	0.076	1.139	275	0.062	0.073	7d63RQ.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state C)
15	PDB:6rlbD	0.076	0.060	1.575	446	0.062	0.045	6rlbD.pdb.gz
16	PDB:5epmC	0.084	0.650	2.179	33	0.018	0.182	5epmC.pdb.gz
17	PDB:6j6qF	0.085	0.146	2.325	161	0.046	0.093	6j6qF.pdb.gz	Structures of the Catalytically Activated Yeast Spliceosome Reveal the Mechanism of Branching.
18	PDB:6mjpC	0.096	0.152	2.325	174	0.034	0.063	6mjpC.pdb.gz	Structural basis of unidirectional export of lipopolysaccharide to the cell surface.
19	PDB:1dppA	0.080	0.055	2.824	507	0.025	0.016	1dppA.pdb.gz	Crystal structure of the dipeptide binding protein from Escherichia coli involved in active transport and chemotaxis.
20	PDB:6ke6RQ	0.074	0.096	2.824	226	0.065	0.093	6ke6RQ.pdb.gz	3.4 angstrom cryo-EM structure of yeast 90S small subunit preribosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18065	0.0	649	325	1.000	1.000	IBP2_HUMAN Insulin-like growth factor-binding protein 2 OS=Homo sapiens OX=9606 GN=IGFBP2 PE=1 SV=2
2	P24853	0.0	510	316	0.834	0.858	IBP2_PIG Insulin-like growth factor-binding protein 2 OS=Sus scrofa OX=9823 GN=IGFBP2 PE=1 SV=2
3	P13384	9.41e-178	496	317	0.809	0.830	IBP2_BOVIN Insulin-like growth factor-binding protein 2 OS=Bos taurus OX=9913 GN=IGFBP2 PE=1 SV=2
4	Q29400	6.73e-175	489	317	0.800	0.820	IBP2_SHEEP Insulin-like growth factor-binding protein 2 OS=Ovis aries OX=9940 GN=IGFBP2 PE=2 SV=1
5	P47877	7.74e-172	480	305	0.751	0.800	IBP2_MOUSE Insulin-like growth factor-binding protein 2 OS=Mus musculus OX=10090 GN=Igfbp2 PE=2 SV=2
6	P12843	2.13e-170	477	304	0.754	0.806	IBP2_RAT Insulin-like growth factor-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Igfbp2 PE=1 SV=3
7	G1NGG4	2.60e-92	275	202	0.425	0.683	G1NGG4_MELGA Thyroglobulin type-1 domain-containing protein OS=Meleagris gallopavo OX=9103 GN=IGFBP2 PE=4 SV=2
8	Q9PTH3	7.96e-82	251	276	0.446	0.525	IBP2A_DANRE Insulin-like growth factor-binding protein 2-A OS=Danio rerio OX=7955 GN=igfbp2a PE=1 SV=1
9	B3F211	8.31e-69	217	265	0.382	0.468	IBP2B_DANRE Insulin-like growth factor-binding protein 2-B OS=Danio rerio OX=7955 GN=igfbp2b PE=1 SV=1
10	C9E9W3	1.97e-47	158	139	0.286	0.669	C9E9W3_BOVIN Insulin-like growth factor binding protein 2 (Fragment) OS=Bos taurus OX=9913 GN=IGFBP2 PE=4 SV=1
11	Q90YJ7	3.67e-43	151	262	0.311	0.385	Q90YJ7_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=IGFBP-1 PE=2 SV=1
12	Q8JHX6	1.04e-42	150	262	0.311	0.385	Q8JHX6_DANRE Insulin-like growth factor-binding protein 1 OS=Danio rerio OX=7955 GN=igfbp1a PE=2 SV=1
13	P22692	5.36e-42	148	258	0.314	0.395	IBP4_HUMAN Insulin-like growth factor-binding protein 4 OS=Homo sapiens OX=9606 GN=IGFBP4 PE=1 SV=2
14	P47876	7.10e-40	143	272	0.305	0.364	IBP1_MOUSE Insulin-like growth factor-binding protein 1 OS=Mus musculus OX=10090 GN=Igfbp1 PE=2 SV=2
15	P47879	7.42e-40	142	254	0.305	0.390	IBP4_MOUSE Insulin-like growth factor-binding protein 4 OS=Mus musculus OX=10090 GN=Igfbp4 PE=1 SV=2
16	P21744	7.66e-40	142	254	0.305	0.390	IBP4_RAT Insulin-like growth factor-binding protein 4 OS=Rattus norvegicus OX=10116 GN=Igfbp4 PE=1 SV=2
17	P15473	7.99e-40	143	292	0.292	0.325	IBP3_RAT Insulin-like growth factor-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Igfbp3 PE=1 SV=2
18	P21743	9.76e-40	142	272	0.308	0.368	IBP1_RAT Insulin-like growth factor-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Igfbp1 PE=1 SV=2
19	P08833	7.75e-39	140	259	0.265	0.332	IBP1_HUMAN Insulin-like growth factor-binding protein 1 OS=Homo sapiens OX=9606 GN=IGFBP1 PE=1 SV=1
20	P47878	7.86e-38	138	292	0.280	0.312	IBP3_MOUSE Insulin-like growth factor-binding protein 3 OS=Mus musculus OX=10090 GN=Igfbp3 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14375 Cys_rich_CWC	6e+02	12.2	Cysteine-rich CWC
2	PF00219 IGFBP	4.3e-09	48.1	Insulin-like growth factor binding protein
3	PF00086 Thyroglobulin_1	1.4e-13	61.5	Thyroglobulin type-1 repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000008875

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000007775	0.953	Insulin-like growth factor 1 (somatomedin C)
2	61853.ENSNLEP00000016278	0.881	Insulin-like growth factor 2 (somatomedin A)
3	61853.ENSNLEP00000021413	0.700	Integrin, alpha 5 (fibronectin receptor, alpha polypeptide)
4	61853.ENSNLEP00000011913	0.693	Migration and invasion inhibitory protein
5	61853.ENSNLEP00000003192	0.657	Alpha-2-macroglobulin
6	61853.ENSNLEP00000013518	0.591	Non imprinted in Prader-Willi/Angelman syndrome 2
7	61853.ENSNLEP00000013446	0.578	Gamma-tubulin complex component
8	61853.ENSNLEP00000020522	0.560	Pappalysin 1
9	61853.ENSNLEP00000000953	0.559	Tyrosine-protein kinase receptor
10	61853.ENSNLEP00000013546	0.559	Non imprinted in Prader-Willi/Angelman syndrome 1
11	61853.ENSNLEP00000021951	0.537	Nuclear receptor subfamily 5, group A, member 2
12	61853.ENSNLEP00000004867	0.519	RAS-like, estrogen-regulated, growth inhibitor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0031994	0.999	insulin-like growth factor I binding
GO:0005102	0.998	signaling receptor binding
GO:0031995	0.346	insulin-like growth factor II binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050896	0.991	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0048583	0.980	regulation of response to stimulus
GO:0048518	0.974	positive regulation of biological process
GO:0023051	0.969	regulation of signaling
GO:0010646	0.969	regulation of cell communication
GO:0009966	0.954	regulation of signal transduction
GO:0009987	0.922	cellular process
GO:0048522	0.834	positive regulation of cellular process
GO:0051239	0.825	regulation of multicellular organismal process
GO:0051716	0.800	cellular response to stimulus
GO:0042127	0.792	regulation of cell population proliferation
GO:0042221	0.789	response to chemical
GO:0048519	0.778	negative regulation of biological process
GO:0030155	0.740	regulation of cell adhesion
GO:0010243	0.733	response to organonitrogen compound
GO:0009725	0.733	response to hormone
GO:1901700	0.713	response to oxygen-containing compound
GO:1901652	0.699	response to peptide
GO:0007154	0.693	cell communication
GO:0048523	0.682	negative regulation of cellular process
GO:0023052	0.638	signaling
GO:0008284	0.623	positive regulation of cell population proliferation
GO:0051240	0.599	positive regulation of multicellular organismal process
GO:0043434	0.599	response to peptide hormone
GO:0032501	0.586	multicellular organismal process
GO:0050865	0.567	regulation of cell activation
GO:0007165	0.556	signal transduction
GO:0032502	0.540	developmental process
GO:0022407	0.534	regulation of cell-cell adhesion
GO:0030111	0.472	regulation of Wnt signaling pathway
GO:0019222	0.463	regulation of metabolic process
GO:0045785	0.453	positive regulation of cell adhesion
GO:0048584	0.443	positive regulation of response to stimulus
GO:1903037	0.426	regulation of leukocyte cell-cell adhesion
GO:0048585	0.419	negative regulation of response to stimulus
GO:0080090	0.382	regulation of primary metabolic process
GO:0002682	0.380	regulation of immune system process
GO:0048856	0.363	anatomical structure development
GO:0023056	0.357	positive regulation of signaling
GO:0010647	0.356	positive regulation of cell communication
GO:0060255	0.352	regulation of macromolecule metabolic process
GO:0022409	0.347	positive regulation of cell-cell adhesion
GO:0050793	0.344	regulation of developmental process
GO:0040008	0.331	regulation of growth
GO:0050867	0.318	positive regulation of cell activation
GO:0009967	0.318	positive regulation of signal transduction
GO:0070887	0.308	cellular response to chemical stimulus
GO:1902531	0.303	regulation of intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.917	membrane-bounded organelle
GO:0071944	0.824	cell periphery
GO:0005622	0.810	intracellular anatomical structure
GO:0043229	0.782	intracellular organelle
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0043233	0.767	organelle lumen
GO:0070013	0.764	intracellular organelle lumen
GO:0005737	0.714	cytoplasm
GO:0070062	0.471	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]