StarFunc result for job id P18074

User Input

>input (760 residues)
MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQ
RAYPLEVTKLIYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPE
VTPLRFGKDVDGKCHSLTASYVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDL
KALGRRQGWCPYFLARYSILHANVVVYSYHYLLDPKIADLVSKELARKAVVVFDEAHNID
NVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQRLRDEYRRLVEGLREASAARE
TDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVVQESPPAFLSG
LAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMAT
FTMTLARVCLCPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFT
SYQYMESTVASWYEQGILENIQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVA
RGKVSEGIDFVHHYGRAVIMFGVPYVYTQSRILKARLEYLRDQFQIRENDFLTFDAMRHA
AQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEHLTDANLNLTVDEGVQVAKYF
LRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7lbmX	0.989	0.989	0.000	760	1.000	1.000	7lbmX.pdb.gz	Structure of the human Mediator-bound transcription preinitiation complex.
2	AFDB:D3DMG9	0.984	0.958	0.000	781	0.683	0.665	D3DMG9.pdb.gz	D3DMG9_DROME General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Drosophila melanogaster OX=7227 GN=Xpd-RA PE=2 SV=1
3	AFDB:D3ZEG9	0.999	0.999	0.000	760	0.978	0.978	D3ZEG9.pdb.gz	D3ZEG9_RAT General transcription and DNA repair factor IIH helicase subunit XPD OS=Rattus norvegicus OX=10116 GN=Ercc2 PE=3 SV=1
4	PDB:7ad8B	0.868	0.975	4.111E-97	675	0.882	0.993	7ad8B.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
5	AFDB:P26659	0.974	0.959	2.046E-94	772	0.555	0.547	P26659.pdb.gz	RAD15_SCHPO General transcription and DNA repair factor IIH helicase subunit XPD OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad15 PE=1 SV=2
6	AFDB:Q55G81	0.965	0.945	9.671E-93	776	0.541	0.530	Q55G81.pdb.gz	ERCC2_DICDI General transcription and DNA repair factor IIH helicase subunit XPD OS=Dictyostelium discoideum OX=44689 GN=repD PE=2 SV=1
7	AFDB:Q8W4M7	0.968	0.971	3.941E-91	758	0.542	0.544	Q8W4M7.pdb.gz	ERCC2_ARATH General transcription and DNA repair factor IIH helicase subunit XPD OS=Arabidopsis thaliana OX=3702 GN=XPD PE=1 SV=1
8	AFDB:P06839	0.972	0.950	9.596E-91	778	0.521	0.509	P06839.pdb.gz	RAD3_YEAST General transcription and DNA repair factor IIH helicase subunit XPD OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD3 PE=1 SV=1
9	AFDB:A0A1D8PQH0	0.968	0.962	2.689E-88	765	0.532	0.528	A0A1D8PQH0.pdb.gz	A0A1D8PQH0_CANAL ATP-dependent DNA helicase CHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD3 PE=3 SV=1
10	AFDB:Q57YJ9	0.919	0.854	1.801E-74	819	0.429	0.398	Q57YJ9.pdb.gz	Q57YJ9_TRYB2 General transcription and DNA repair factor IIH helicase subunit XPD OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.890 PE=3 SV=1
11	PDB:7k010	0.951	0.958	1.392E-73	754	0.520	0.524	7k010.pdb.gz	Cryo-EM structure of TFIIH/Rad4-Rad23-Rad33 in damaged DNA opening in nucleotide excision repair.
12	AFDB:Q8I2H7	0.922	0.669	2.177E-72	1056	0.413	0.297	Q8I2H7.pdb.gz	Q8I2H7_PLAF7 DNA helicase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0934100 PE=3 SV=1
13	AFDB:Q9W484	0.777	0.608	3.928E-46	985	0.242	0.187	Q9W484.pdb.gz	RTEL1_DROME Regulator of telomere elongation helicase 1 homolog OS=Drosophila melanogaster OX=7227 GN=Rtel1 PE=1 SV=1
14	PDB:5fmfY	0.605	0.774	5.553E-35	578	0.334	0.439	5fmfY.pdb.gz	Structure of an RNA Polymerase II Pre-Initiation Complex
15	PDB:5svaY	0.567	0.745	1.166E-34	562	0.364	0.493	5svaY.pdb.gz	Structure of a Complete Mediator-RNA Polymerase II Pre-Initiation Complex.
16	PDB:6fwrA	0.582	0.627	1.290E-22	699	0.153	0.166	6fwrA.pdb.gz	DNA translocation mechanism of an XPD family helicase.
17	PDB:3crvA	0.516	0.686	2.687E-20	551	0.163	0.225	3crvA.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
18	PDB:3crw1	0.454	0.675	9.563E-16	485	0.136	0.212	3crw1.pdb.gz	XPD helicase structures and activities: insights into the cancer and aging phenotypes from XPD mutations.
19	PDB:3uwxB	0.333	0.410	1.045E-6	595	0.109	0.139	3uwxB.pdb.gz	Structure and mechanism of the UvrA-UvrB DNA damage sensor.
20	PDB:4uaqA	0.302	0.322	1.930E-5	705	0.112	0.121	4uaqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A1D8PQH0	851	765	0.528	0.524	A0A1D8PQH0_CANAL ATP-dependent DNA helicase CHL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD3 PE=3 SV=1
2	A0A8I6A002	1030	508	0.655	0.980	A0A8I6A002_RAT DNA helicase OS=Rattus norvegicus OX=10116 GN=Ercc2 PE=1 SV=1
3	A0A8I6AH26	1528	785	0.978	0.946	A0A8I6AH26_RAT General transcription and DNA repair factor IIH helicase subunit XPD OS=Rattus norvegicus OX=10116 GN=Ercc2 PE=1 SV=1
4	A8MX75	1464	706	0.929	1.000	A8MX75_HUMAN General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Homo sapiens OX=9606 GN=ERCC2 PE=1 SV=2
5	D3DMG9	1120	781	0.686	0.667	D3DMG9_DROME General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Drosophila melanogaster OX=7227 GN=Xpd-RA PE=2 SV=1
6	D3ZEG9	1543	760	0.978	0.978	D3ZEG9_RAT General transcription and DNA repair factor IIH helicase subunit XPD OS=Rattus norvegicus OX=10116 GN=Ercc2 PE=3 SV=1
7	K7EIT8	605	292	0.384	1.000	K7EIT8_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=ERCC2 PE=1 SV=1
8	O08811	1541	760	0.975	0.975	ERCC2_MOUSE General transcription and DNA repair factor IIH helicase subunit XPD OS=Mus musculus OX=10090 GN=Ercc2 PE=1 SV=2
9	P06839	835	778	0.521	0.509	RAD3_YEAST General transcription and DNA repair factor IIH helicase subunit XPD OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RAD3 PE=1 SV=1
10	P18074	1572	760	1.000	1.000	ERCC2_HUMAN General transcription and DNA repair factor IIH helicase subunit XPD OS=Homo sapiens OX=9606 GN=ERCC2 PE=1 SV=1
11	P26659	898	772	0.551	0.543	RAD15_SCHPO General transcription and DNA repair factor IIH helicase subunit XPD OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad15 PE=1 SV=2
12	Q55G81	880	776	0.547	0.536	ERCC2_DICDI General transcription and DNA repair factor IIH helicase subunit XPD OS=Dictyostelium discoideum OX=44689 GN=repD PE=2 SV=1
13	Q57YJ9	650	819	0.436	0.404	Q57YJ9_TRYB2 General transcription and DNA repair factor IIH helicase subunit XPD OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.11J15.890 PE=3 SV=1
14	Q6TY68	984	685	0.597	0.663	Q6TY68_DROME General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Drosophila melanogaster OX=7227 GN=Xpd PE=3 SV=1
15	Q6TY70	977	685	0.595	0.660	Q6TY70_DROME General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Drosophila melanogaster OX=7227 GN=Xpd PE=3 SV=1
16	Q6TY75	983	685	0.599	0.664	Q6TY75_DROME General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Drosophila melanogaster OX=7227 GN=Xpd PE=3 SV=1
17	Q6TY79	986	685	0.600	0.666	Q6TY79_DROME General transcription and DNA repair factor IIH helicase subunit XPD (Fragment) OS=Drosophila melanogaster OX=7227 GN=Xpd PE=3 SV=1
18	Q7KVP9	1119	769	0.686	0.678	Q7KVP9_DROME General transcription and DNA repair factor IIH helicase subunit XPD OS=Drosophila melanogaster OX=7227 GN=Xpd PE=1 SV=1
19	Q8W4M7	877	758	0.542	0.544	ERCC2_ARATH General transcription and DNA repair factor IIH helicase subunit XPD OS=Arabidopsis thaliana OX=3702 GN=XPD PE=1 SV=1
20	Q9XYZ2	1075	745	0.659	0.672	Q9XYZ2_DROME General transcription and DNA repair factor IIH helicase subunit XPD OS=Drosophila melanogaster OX=7227 GN=Xpd PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	5.3	18.8	AAA domain
2	PF06733 DEAD_2	4e-43	158.6	DEAD_2
3	PF06777 HBB	1.6e-42	156.9	Helical and beta-bridge domain
4	PF13307 Helicase_C_2	5e-42	155.4	Helicase C-terminal domain
5	PF02562 PhoH	1.6e+02	13.1	PhoH-like protein
6	PF04851 ResIII	0.016	26.7	Type III restriction enzyme, res subunit
7	PF17107 SesA	93	14.6	N-terminal domain on NACHT_NTPase and P-loop NTPases
8	PF00176 SNF2-rel_dom	0.31	21.5	SNF2-related domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000375809

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000256443	0.999	Cyclin-dependent kinase 7
2	9606.ENSP00000256897	0.999	Cyclin-H
3	9606.ENSP00000259895	0.999	General transcription factor IIH subunit 4
4	9606.ENSP00000261245	0.999	CDK-activating kinase assembly factor MAT1
5	9606.ENSP00000265963	0.999	General transcription factor IIH subunit 1
6	9606.ENSP00000283875	0.999	General transcription factor IIE subunit 1
7	9606.ENSP00000285398	0.999	TFIIH basal transcription factor complex helicase XPB subunit
8	9606.ENSP00000328901	0.999	General transcription factor IIH subunit 2
9	9606.ENSP00000348168	0.999	Transcription initiation factor IIE subunit beta
10	9606.ENSP00000445162	0.999	General transcription factor IIH subunit 3
11	9606.ENSP00000476100	0.999	General transcription factor IIH subunit 5
12	9606.ENSP00000412698	0.998	MMS19 nucleotide excision repair protein homolog
13	9606.ENSP00000377969	0.995	General transcription factor IIF subunit 1
14	9606.ENSP00000359531	0.994	Transcription initiation factor IIB
15	9606.ENSP00000364270	0.994	DNA repair protein complementing XP-A cells
16	9606.ENSP00000379372	0.992	Transcription initiation factor IIA subunit 2
17	9606.ENSP00000375942	0.990	TATA-box-binding protein
18	9606.ENSP00000428426	0.990	Transcription elongation factor A protein 1
19	9606.ENSP00000452454	0.989	Transcription initiation factor IIA subunit 1
20	9606.ENSP00000387471	0.986	Mitotic spindle-associated MMXD complex subunit MIP18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003678	0.999	DNA helicase activity
GO:0043139	0.994	5'-3' DNA helicase activity
GO:0060090	0.816	molecular adaptor activity
GO:1901363	0.670	heterocyclic compound binding
GO:0097159	0.670	organic cyclic compound binding
GO:0030674	0.561	protein-macromolecule adaptor activity
GO:0003677	0.461	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.983	response to stimulus
GO:0009987	0.961	cellular process
GO:0006950	0.936	response to stress
GO:0071704	0.820	organic substance metabolic process
GO:0044238	0.811	primary metabolic process
GO:0044237	0.811	cellular metabolic process
GO:0006807	0.798	nitrogen compound metabolic process
GO:0043170	0.794	macromolecule metabolic process
GO:0090304	0.776	nucleic acid metabolic process
GO:0048856	0.731	anatomical structure development
GO:0051716	0.716	cellular response to stimulus
GO:0006974	0.712	cellular response to DNA damage stimulus
GO:0032501	0.636	multicellular organismal process
GO:0065007	0.620	biological regulation
GO:0007275	0.599	multicellular organism development
GO:0009628	0.559	response to abiotic stimulus
GO:0050789	0.536	regulation of biological process
GO:0050794	0.501	regulation of cellular process
GO:0006259	0.420	DNA metabolic process
GO:0006281	0.395	DNA repair
GO:0009058	0.344	biosynthetic process
GO:0034654	0.329	nucleobase-containing compound biosynthetic process
GO:0009059	0.311	macromolecule biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.997	nucleoplasm
GO:0090575	0.995	RNA polymerase II transcription regulator complex
GO:0000439	0.982	transcription factor TFIIH core complex
GO:0005829	0.947	cytosol
GO:0043232	0.909	intracellular non-membrane-bounded organelle
GO:0140535	0.853	intracellular protein-containing complex
GO:1902494	0.846	catalytic complex
GO:1990234	0.831	transferase complex
GO:0061695	0.802	transferase complex, transferring phosphorus-containing groups
GO:0016591	0.635	RNA polymerase II, holoenzyme
GO:1902554	0.529	serine/threonine protein kinase complex
GO:0005675	0.369	transcription factor TFIIH holo complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.2.3	0.994	DNA 5'-3' helicase.

[back to server]