StarFunc result for job id P18075

User Input

>input (431 residues)
MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILS
ILGLPHRPRPHLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLAS
LQDSHFLTDADMVMSFVNLVEHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDY
IRERFDNETFRISVYQVLQEHLGRESDLFLLDSRTLWASEEGWLVFDITATSNHWVVNPR
HNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAFFKATEVHFRSIRSTGSKQRS
QNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIAPEGYAAYYCE
GECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY
RNMVVRACGCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A8K571	0.835	0.835	1.118E-75	431	1.000	1.000	A8K571.pdb.gz	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
2	AFDB:F1NUT2	0.867	0.806	2.560E-69	465	0.872	0.809	F1NUT2.pdb.gz
3	AFDB:A0A0R4ILD5	0.815	0.789	9.380E-60	446	0.652	0.630	A0A0R4ILD5.pdb.gz
4	AFDB:F1P4H2	0.856	0.850	9.370E-58	434	0.636	0.631	F1P4H2.pdb.gz
5	AFDB:Q9PTF9	0.826	0.824	1.047E-57	432	0.652	0.650	Q9PTF9.pdb.gz	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
6	AFDB:P22004	0.781	0.660	5.085E-56	513	0.633	0.532	P22004.pdb.gz	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
7	AFDB:P34821	0.773	0.833	5.208E-49	399	0.497	0.536	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
8	AFDB:P34820	0.773	0.827	2.602E-48	402	0.478	0.512	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
9	AFDB:P55105	0.749	0.805	1.162E-45	399	0.457	0.494	P55105.pdb.gz	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
10	AFDB:D4A7P9	0.371	0.523	5.051E-44	302	0.480	0.685	D4A7P9.pdb.gz	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
11	PDB:5hlyA	0.261	0.352	2.698E-16	299	0.181	0.261	5hlyA.pdb.gz
12	PDB:5ntuA	0.249	0.338	9.928E-15	308	0.193	0.269	5ntuA.pdb.gz
13	PDB:6umxA	0.318	0.459	3.183E-14	279	0.162	0.251	6umxA.pdb.gz
14	PDB:5nxsA	0.243	0.346	1.274E-13	290	0.183	0.272	5nxsA.pdb.gz
15	PDB:3rjrC	0.268	0.329	1.309E-12	343	0.211	0.265	3rjrC.pdb.gz
16	PDB:5vqfB	0.259	0.334	1.546E-12	320	0.172	0.231	5vqfB.pdb.gz
17	PDB:5ffoG	0.299	0.413	5.689E-11	297	0.193	0.279	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.247	0.331	4.191E-10	308	0.172	0.240	7y1rB.pdb.gz
19	PDB:5nxsB	0.213	0.353	5.232E-10	251	0.162	0.279	5nxsB.pdb.gz
20	PDB:6q2sA	0.150	0.532	4.415E-4	98	0.058	0.255	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8K571	0.0	905	431	1.000	1.000	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
2	D4A7P9	0.0	579	454	0.652	0.619	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
3	G3V6W8	0.0	881	430	0.974	0.977	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
4	P18075	0.0	905	431	1.000	1.000	BMP7_HUMAN Bone morphogenetic protein 7 OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
5	P22003	0.0	580	454	0.664	0.630	BMP5_HUMAN Bone morphogenetic protein 5 OS=Homo sapiens OX=9606 GN=BMP5 PE=1 SV=1
6	P22004	0.0	522	513	0.622	0.522	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
7	P23359	0.0	881	430	0.974	0.977	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2
8	P49003	0.0	580	452	0.652	0.622	BMP5_MOUSE Bone morphogenetic protein 5 OS=Mus musculus OX=10090 GN=Bmp5 PE=1 SV=1
9	Q04906	0.0	519	506	0.629	0.536	BMP6_RAT Bone morphogenetic protein 6 OS=Rattus norvegicus OX=10116 GN=Bmp6 PE=2 SV=2
10	Q7T288	0.0	576	446	0.652	0.630	Q7T288_DANRE Bone morphogenetic protein 5 OS=Danio rerio OX=7955 GN=bmp5l PE=2 SV=1
11	Q9I8T6	0.0	739	398	0.826	0.894	Q9I8T6_CHICK Bone morphogenetic protein 7 (Fragment) OS=Gallus gallus OX=9031 GN=BMP7 PE=2 SV=1
12	Q9PTF9	0.0	592	432	0.661	0.660	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
13	Q9R228	0.0	622	306	0.682	0.961	Q9R228_RAT Bone morphogenetic protein 7 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
14	A0A8I6A920	3.19e-180	508	364	0.573	0.679	A0A8I6A920_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
15	P20722	5.83e-180	513	510	0.624	0.527	BMP6_MOUSE Bone morphogenetic protein 6 OS=Mus musculus OX=10090 GN=Bmp6 PE=1 SV=2
16	P34821	1.24e-138	404	399	0.483	0.521	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
17	Q7Z5Y6	5.55e-135	395	402	0.480	0.515	BMP8A_HUMAN Bone morphogenetic protein 8A OS=Homo sapiens OX=9606 GN=BMP8A PE=2 SV=2
18	P34820	1.28e-134	394	402	0.478	0.512	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
19	P55105	3.90e-131	385	399	0.455	0.491	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
20	P27091	7.84e-85	268	455	0.376	0.356	60A_DROME Protein 60A OS=Drosophila melanogaster OX=7227 GN=gbb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.8e-90	314.4	TGF-beta propeptide
2	PF00019 TGF_beta	1.2e-34	130.6	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011538

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000012260	0.997	Serine/threonine-protein kinase receptor
2	60711.ENSCSAP00000012006	0.995	Serine/threonine-protein kinase receptor
3	60711.ENSCSAP00000017457	0.993	Inhibitor of bone morphogenetic proteins (BMP) signaling which is required for growth and patterning of the neural tube and somite
4	60711.ENSCSAP00000005943	0.992	Bone morphogenetic protein receptor, type IA
5	60711.ENSCSAP00000006711	0.983	Bone morphogenetic protein receptor, type II (serine/threonine kinase)
6	60711.ENSCSAP00000010618	0.976	Serine/threonine-protein kinase receptor
7	60711.ENSCSAP00000000496	0.956	Serine/threonine-protein kinase receptor
8	60711.ENSCSAP00000009897	0.918	Dorsalizing factor. Key developmental protein that dorsalizes early vertebrate embryonic tissues by binding to ventralizing TGF-beta family bone morphogenetic proteins (BMPs) and sequestering them in latent complexes
9	60711.ENSCSAP00000019251	0.889	Gremlin 1, DAN family BMP antagonist
10	60711.ENSCSAP00000009587	0.886	Sclerostin domain containing 1
11	60711.ENSCSAP00000009511	0.870	Mothers against decapentaplegic homolog
12	60711.ENSCSAP00000018880	0.864	Gremlin 2, DAN family BMP antagonist
13	60711.ENSCSAP00000004368	0.863	Growth differentiation factor 7
14	60711.ENSCSAP00000012689	0.838	Follistatin
15	60711.ENSCSAP00000014620	0.835	Mothers against decapentaplegic homolog
16	60711.ENSCSAP00000009415	0.826	Mothers against decapentaplegic homolog
17	60711.ENSCSAP00000010950	0.821	Bone morphogenetic protein 4
18	60711.ENSCSAP00000009677	0.813	Bone morphogenetic protein 2
19	60711.ENSCSAP00000013893	0.802	Mothers against decapentaplegic homolog
20	60711.ENSCSAP00000001803	0.754	On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Receptor for anti-Muellerian hormone.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.989	signaling receptor binding
GO:0098772	0.908	molecular function regulator activity
GO:0140677	0.903	molecular function activator activity
GO:0048018	0.826	receptor ligand activity
GO:0042802	0.680	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009719	0.978	response to endogenous stimulus
GO:0048856	0.977	anatomical structure development
GO:0050794	0.977	regulation of cellular process
GO:0032501	0.976	multicellular organismal process
GO:0009987	0.976	cellular process
GO:0007275	0.974	multicellular organism development
GO:0031323	0.970	regulation of cellular metabolic process
GO:0048518	0.969	positive regulation of biological process
GO:0051716	0.967	cellular response to stimulus
GO:0007154	0.965	cell communication
GO:0007165	0.962	signal transduction
GO:0070848	0.959	response to growth factor
GO:0048731	0.955	system development
GO:0071363	0.952	cellular response to growth factor stimulus
GO:0007178	0.950	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010468	0.947	regulation of gene expression
GO:0048519	0.941	negative regulation of biological process
GO:0009888	0.933	tissue development
GO:0050793	0.932	regulation of developmental process
GO:0048522	0.924	positive regulation of cellular process
GO:0010556	0.916	regulation of macromolecule biosynthetic process
GO:0048869	0.915	cellular developmental process
GO:0048513	0.914	animal organ development
GO:0023051	0.909	regulation of signaling
GO:0010646	0.907	regulation of cell communication
GO:0051174	0.906	regulation of phosphorus metabolic process
GO:2001141	0.905	regulation of RNA biosynthetic process
GO:0051173	0.888	positive regulation of nitrogen compound metabolic process
GO:0051094	0.886	positive regulation of developmental process
GO:0009966	0.877	regulation of signal transduction
GO:0051239	0.870	regulation of multicellular organismal process
GO:0023056	0.869	positive regulation of signaling
GO:0010647	0.869	positive regulation of cell communication
GO:0010604	0.869	positive regulation of macromolecule metabolic process
GO:0090092	0.853	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0042221	0.844	response to chemical
GO:0045597	0.841	positive regulation of cell differentiation
GO:0001934	0.839	positive regulation of protein phosphorylation
GO:0071772	0.837	response to BMP
GO:0045667	0.830	regulation of osteoblast differentiation
GO:0051093	0.827	negative regulation of developmental process
GO:0071773	0.819	cellular response to BMP stimulus
GO:0030509	0.794	BMP signaling pathway
GO:2000026	0.784	regulation of multicellular organismal development
GO:0010033	0.772	response to organic substance
GO:0009967	0.765	positive regulation of signal transduction
GO:0060393	0.744	regulation of pathway-restricted SMAD protein phosphorylation
GO:0048523	0.741	negative regulation of cellular process
GO:0042127	0.732	regulation of cell population proliferation
GO:0006355	0.709	regulation of DNA-templated transcription
GO:1902531	0.703	regulation of intracellular signal transduction
GO:0009605	0.671	response to external stimulus
GO:1901700	0.671	response to oxygen-containing compound
GO:0051240	0.668	positive regulation of multicellular organismal process
GO:0046883	0.646	regulation of hormone secretion
GO:0033273	0.627	response to vitamin
GO:0014070	0.616	response to organic cyclic compound
GO:2000831	0.616	regulation of steroid hormone secretion
GO:0032355	0.589	response to estradiol
GO:0033280	0.583	response to vitamin D
GO:0030154	0.573	cell differentiation
GO:0043434	0.559	response to peptide hormone
GO:0009653	0.558	anatomical structure morphogenesis
GO:0006357	0.512	regulation of transcription by RNA polymerase II
GO:0032370	0.501	positive regulation of lipid transport
GO:0009892	0.497	negative regulation of metabolic process
GO:0031328	0.437	positive regulation of cellular biosynthetic process
GO:0010605	0.435	negative regulation of macromolecule metabolic process
GO:0010557	0.424	positive regulation of macromolecule biosynthetic process
GO:0045893	0.407	positive regulation of DNA-templated transcription
GO:0051172	0.371	negative regulation of nitrogen compound metabolic process
GO:0090100	0.329	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0008152	0.322	metabolic process
GO:0031324	0.310	negative regulation of cellular metabolic process
GO:0065009	0.304	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0043227	0.956	membrane-bounded organelle
GO:0071944	0.909	cell periphery
GO:0005622	0.772	intracellular anatomical structure
GO:0043231	0.713	intracellular membrane-bounded organelle
GO:0031982	0.531	vesicle
GO:0005737	0.488	cytoplasm
GO:0070013	0.402	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]