StarFunc result for job id P18089

User Input

>input (450 residues)
MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADIL
VATLIIPFSLANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEY
NSKRTPRRIKCIILTVWLIAAVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGS
FFAPCLIMILVYLRIYLIAKRSNRRGPRAKGGPGQGESKQPRPDHGGALASAKLPALASV
ASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNSGQGQKEGVCGASPEDEAEEE
EEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIGGQWWRRR
AQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSS
LNPVIYTIFNQDFRRAFRRILCRPWTQTAW

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18089	1.000	1.000	1.074E-54	450	1.000	1.000	P18089.pdb.gz	ADA2B_HUMAN Alpha-2B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2B PE=1 SV=4
2	AFDB:P19328	0.743	0.738	9.481E-44	453	0.844	0.839	P19328.pdb.gz	ADA2B_RAT Alpha-2B adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2b PE=1 SV=2
3	AFDB:Q90WY5	0.644	0.570	6.885E-32	510	0.551	0.486	Q90WY5.pdb.gz	ADA2B_DANRE Alpha-2B adrenergic receptor OS=Danio rerio OX=7955 GN=adra2b PE=3 SV=1
4	AFDB:A0A060W139	0.654	0.750	5.302E-30	390	0.469	0.541	A0A060W139.pdb.gz	A0A060W139_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077426001 PE=3 SV=1
5	AFDB:P08913	0.640	0.620	5.302E-30	465	0.511	0.495	P08913.pdb.gz	ADA2A_HUMAN Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4
6	AFDB:Q90WY6	0.640	0.666	5.779E-30	432	0.498	0.519	Q90WY6.pdb.gz	ADA2C_DANRE Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1
7	AFDB:A0A060YDW5	0.636	0.641	1.426E-29	446	0.511	0.516	A0A060YDW5.pdb.gz	A0A060YDW5_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037859001 PE=3 SV=1
8	AFDB:A0A060YLN9	0.647	0.763	1.927E-29	380	0.473	0.561	A0A060YLN9.pdb.gz	A0A060YLN9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008424001 PE=3 SV=1
9	AFDB:A0A060X9D7	0.643	0.599	2.100E-29	484	0.509	0.473	A0A060X9D7.pdb.gz	A0A060X9D7_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00051689001 PE=3 SV=1
10	AFDB:P18825	0.641	0.625	3.673E-29	462	0.500	0.487	P18825.pdb.gz	ADA2C_HUMAN Alpha-2C adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2C PE=1 SV=2
11	PDB:7ejaR	0.542	0.887	5.851E-19	269	0.436	0.729	7ejaR.pdb.gz	Structural insights into ligand recognition, activation, and signaling of the alpha 2A adrenergic receptor.
12	PDB:7e32R	0.561	0.869	3.551E-16	285	0.240	0.379	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:3pblA	0.563	0.586	4.597E-16	432	0.276	0.287	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
14	PDB:7e2xR	0.544	0.864	5.570E-15	278	0.242	0.392	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
15	PDB:6iblA	0.543	0.613	1.564E-14	397	0.253	0.287	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
16	PDB:7jvqR	0.546	0.840	2.113E-14	286	0.247	0.388	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:7f61A	0.574	0.839	6.192E-14	301	0.227	0.339	7f61A.pdb.gz	Structural basis for recognition of antihistamine drug by human histamine receptor.
18	PDB:7cmuR	0.544	0.882	8.015E-14	272	0.260	0.430	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.
19	PDB:5d5aA	0.567	0.577	1.286E-13	442	0.240	0.244	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.
20	PDB:7xt8R	0.529	0.794	2.065E-13	294	0.240	0.367	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18089	0.0	919	450	1.000	1.000	ADA2B_HUMAN Alpha-2B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2B PE=1 SV=4
2	P19328	0.0	723	453	0.842	0.837	ADA2B_RAT Alpha-2B adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2b PE=1 SV=2
3	P30545	0.0	710	453	0.831	0.826	ADA2B_MOUSE Alpha-2B adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2b PE=1 SV=3
4	Q90WY6	2.27e-146	426	432	0.507	0.528	ADA2C_DANRE Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1
5	P22909	1.75e-145	425	465	0.540	0.523	ADA2A_RAT Alpha-2A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2a PE=1 SV=3
6	A0A060XV00	5.36e-144	422	489	0.529	0.487	A0A060XV00_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044866001 PE=3 SV=1
7	Q01338	1.69e-142	417	465	0.533	0.516	ADA2A_MOUSE Alpha-2A adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2a PE=1 SV=2
8	A0A060X9D7	2.23e-142	417	484	0.540	0.502	A0A060X9D7_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00051689001 PE=3 SV=1
9	A0A060YLN9	8.40e-142	412	380	0.489	0.579	A0A060YLN9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008424001 PE=3 SV=1
10	A0A060YRM0	1.10e-141	412	395	0.480	0.547	A0A060YRM0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023164001 PE=3 SV=1
11	P18871	4.10e-141	414	465	0.520	0.503	ADA2A_PIG Alpha-2A adrenergic receptor OS=Sus scrofa OX=9823 GN=ADRA2A PE=1 SV=2
12	A0A060YDW5	2.76e-140	411	446	0.511	0.516	A0A060YDW5_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00037859001 PE=3 SV=1
13	P08913	6.14e-140	410	465	0.533	0.516	ADA2A_HUMAN Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4
14	A0A060W139	9.85e-140	407	390	0.482	0.556	A0A060W139_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077426001 PE=3 SV=1
15	A0A060W6G8	3.16e-139	406	390	0.487	0.562	A0A060W6G8_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00082532001 PE=3 SV=1
16	A0A060Y7B7	1.48e-134	397	475	0.520	0.493	A0A060Y7B7_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00056770001 PE=3 SV=1
17	A0A060YPY0	1.67e-121	361	384	0.476	0.557	A0A060YPY0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028829001 PE=3 SV=1
18	A0A060YTQ8	1.00e-120	358	384	0.473	0.555	A0A060YTQ8_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00013280001 PE=3 SV=1
19	Q8JG69	6.59e-119	355	415	0.449	0.487	AA2DB_DANRE Alpha-2Db adrenergic receptor OS=Danio rerio OX=7955 GN=adra2db PE=3 SV=1
20	Q90WY4	1.36e-118	353	388	0.471	0.546	ADA2A_DANRE Alpha-2A adrenergic receptor OS=Danio rerio OX=7955 GN=adra2a PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	1.3e-70	249.3	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	7.9e-06	37.4	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	4e-12	57.6	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF10328 7TM_GPCR_Srx	0.34	22.0	Serpentine type 7TM GPCR chemoreceptor Srx
5	PF15451 DUF4632	6.9e+02	11.7	Domain of unknown function (DUF4632)
6	PF01699 Na_Ca_ex	62	15.0	Sodium/calcium exchanger protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000300935	0.901	Ras-related protein Rab-8A
2	9606.ENSP00000343405	0.858	Protein transport protein Sec24C
3	9606.ENSP00000428564	0.833	Protein transport protein Sec24B
4	9606.ENSP00000078429	0.806	Guanine nucleotide-binding protein subunit alpha-11
5	9606.ENSP00000229264	0.726	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
6	9606.ENSP00000286548	0.703	Guanine nucleotide-binding protein G(q) subunit alpha
7	9606.ENSP00000297313	0.701	Regulator of G-protein signaling 20
8	9606.ENSP00000312126	0.691	Adenylate cyclase type 4
9	9606.ENSP00000378217	0.691	Protein kinase C delta type
10	9606.ENSP00000294016	0.689	Adenylate cyclase type 9
11	9606.ENSP00000329127	0.682	Protein kinase C eta type
12	9606.ENSP00000305355	0.680	Protein kinase C beta type
13	9606.ENSP00000419361	0.671	Adenylate cyclase type 5
14	9606.ENSP00000306124	0.667	Protein kinase C epsilon type
15	9606.ENSP00000408695	0.667	Protein kinase C alpha type
16	9606.ENSP00000260600	0.663	Adenylate cyclase type 3
17	9606.ENSP00000263431	0.663	Protein kinase C gamma type
18	9606.ENSP00000286355	0.663	Adenylate cyclase type 8
19	9606.ENSP00000297323	0.663	Adenylate cyclase type 1
20	9606.ENSP00000311405	0.663	Adenylate cyclase type 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004936	1.000	alpha-adrenergic receptor activity
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0007165	0.985	signal transduction
GO:0007186	0.947	G protein-coupled receptor signaling pathway
GO:0032501	0.888	multicellular organismal process
GO:0048519	0.873	negative regulation of biological process
GO:0010646	0.864	regulation of cell communication
GO:0023051	0.857	regulation of signaling
GO:0032879	0.721	regulation of localization
GO:0048583	0.712	regulation of response to stimulus
GO:0048518	0.679	positive regulation of biological process
GO:0009966	0.651	regulation of signal transduction
GO:0051049	0.643	regulation of transport
GO:0048522	0.615	positive regulation of cellular process
GO:0048584	0.539	positive regulation of response to stimulus
GO:1902533	0.502	positive regulation of intracellular signal transduction
GO:0051046	0.419	regulation of secretion
GO:0032502	0.332	developmental process
GO:0065008	0.317	regulation of biological quality
GO:0019222	0.304	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005622	0.795	intracellular anatomical structure
GO:0043226	0.771	organelle
GO:0005737	0.728	cytoplasm
GO:0043227	0.709	membrane-bounded organelle
GO:0043229	0.681	intracellular organelle
GO:0043231	0.401	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]