StarFunc result for job id P18146

User Input

>input (543 residues)
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGS
NSSSSSSGGGGGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETS
YPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAAS
SASASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAY
PAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSG
SQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIR
IHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSS
TYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTI
EIC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18146	0.999	0.999	2.477E-79	543	1.000	1.000	P18146.pdb.gz	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
2	AFDB:P11161	0.190	0.215	9.303E-21	476	0.343	0.391	P11161.pdb.gz	EGR2_HUMAN E3 SUMO-protein ligase EGR2 OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=3
3	AFDB:P08152	0.191	0.218	1.299E-20	470	0.341	0.394	P08152.pdb.gz	EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus OX=10090 GN=Egr2 PE=1 SV=3
4	AFDB:A0A024RDY6	0.146	0.149	2.577E-12	532	0.186	0.190	A0A024RDY6.pdb.gz
5	AFDB:Q9VED3	0.188	0.087	8.312E-11	1186	0.250	0.115	Q9VED3.pdb.gz	Q9VED3_DROME Stripe, isoform A OS=Drosophila melanogaster OX=7227 GN=sr PE=4 SV=1
6	AFDB:A0A0A0MT54	0.165	0.171	1.241E-10	522	0.203	0.211	A0A0A0MT54.pdb.gz	A0A0A0MT54_HUMAN Wilms tumor protein OS=Homo sapiens OX=9606 GN=WT1 PE=1 SV=2
7	AFDB:P41696	0.158	0.096	4.130E-10	914	0.212	0.126	P41696.pdb.gz	AZF1_YEAST Transcription factor AZF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AZF1 PE=1 SV=1
8	AFDB:Q96T25	0.165	0.136	5.395E-10	663	0.225	0.184	Q96T25.pdb.gz	ZIC5_HUMAN Zinc finger protein ZIC 5 OS=Homo sapiens OX=9606 GN=ZIC5 PE=1 SV=2
9	AFDB:Q5BIH1	0.143	0.097	1.286E-9	803	0.212	0.143	Q5BIH1.pdb.gz	Q5BIH1_DROME RE58581p OS=Drosophila melanogaster OX=7227 GN=klu PE=2 SV=1
10	AFDB:Q7K9G4	0.125	0.086	1.920E-9	806	0.192	0.129	Q7K9G4.pdb.gz	Q7K9G4_DROME Zinc finger transcription factor OS=Drosophila melanogaster OX=7227 GN=lmd PE=2 SV=1
11	PDB:7ad8D	0.041	0.068	2.858	280	0.020	0.039	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
12	PDB:5gm6a	0.047	0.130	4.268	123	0.026	0.114	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:6cp37	0.054	0.163	5.960	171	0.020	0.064	6cp37.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
14	PDB:4r8pL	0.033	0.057	6.372	254	0.028	0.059	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
15	PDB:6htsR	0.044	0.289	6.372	72	0.017	0.125	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
16	PDB:6vk0C	0.055	0.122	6.812	180	0.007	0.022	6vk0C.pdb.gz
17	PDB:6lss7	0.064	0.160	7.786	135	0.022	0.089	6lss7.pdb.gz	Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0H2UHR3	0.0	874	536	0.902	0.914	A0A0H2UHR3_RAT Early growth response protein OS=Rattus norvegicus OX=10116 GN=Egr1 PE=3 SV=1
2	A0MWD2	0.0	684	510	0.698	0.743	A0MWD2_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=zenk PE=2 SV=1
3	J7JV33	0.0	685	510	0.698	0.743	J7JV33_TAEGU Early growth response protein OS=Taeniopygia guttata OX=59729 GN=Egr1 PE=2 SV=1
4	P08046	0.0	888	533	0.899	0.916	EGR1_MOUSE Early growth response protein 1 OS=Mus musculus OX=10090 GN=Egr1 PE=1 SV=2
5	P08154	0.0	818	508	0.851	0.909	EGR1_RAT Early growth response protein 1 OS=Rattus norvegicus OX=10116 GN=Egr1 PE=1 SV=2
6	P18146	0.0	1086	543	1.000	1.000	EGR1_HUMAN Early growth response protein 1 OS=Homo sapiens OX=9606 GN=EGR1 PE=1 SV=1
7	Q546S1	0.0	1086	543	1.000	1.000	Q546S1_HUMAN Early growth response protein OS=Homo sapiens OX=9606 GN=EGR1 PE=3 SV=1
8	Q5ZLU9	0.0	679	510	0.707	0.753	Q5ZLU9_CHICK Early growth response protein OS=Gallus gallus OX=9031 GN=RCJMB04_4l24 PE=2 SV=1
9	Q8QG62	0.0	677	510	0.707	0.753	Q8QG62_CHICK Early growth response protein OS=Gallus gallus OX=9031 GN=EGR1 PE=2 SV=1
10	P26632	9.58e-173	499	511	0.578	0.614	EGR1_DANRE Early growth response protein 1 OS=Danio rerio OX=7955 GN=egr1 PE=2 SV=2
11	P43300	1.92e-88	279	387	0.331	0.465	EGR3_MOUSE Early growth response protein 3 OS=Mus musculus OX=10090 GN=Egr3 PE=2 SV=2
12	Q06889	4.78e-88	278	387	0.331	0.465	EGR3_HUMAN Early growth response protein 3 OS=Homo sapiens OX=9606 GN=EGR3 PE=2 SV=1
13	O73693	1.57e-85	265	193	0.269	0.756	EGR1_TAEGU Early growth response protein 1 (Fragment) OS=Taeniopygia guttata OX=59729 GN=EGR1 PE=3 SV=1
14	O73692	3.56e-84	261	194	0.276	0.773	EGR1_COTJA Early growth response protein 1 (Fragment) OS=Coturnix japonica OX=93934 GN=EGR1 PE=3 SV=1
15	O73691	3.47e-79	248	194	0.271	0.758	EGR1_CHICK Early growth response protein 1 (Fragment) OS=Gallus gallus OX=9031 GN=EGR1 PE=3 SV=1
16	Q05159	1.75e-76	249	412	0.324	0.427	EGR2B_DANRE Early growth response protein 2b OS=Danio rerio OX=7955 GN=egr2b PE=2 SV=1
17	P08152	2.86e-74	245	470	0.319	0.368	EGR2_MOUSE E3 SUMO-protein ligase EGR2 OS=Mus musculus OX=10090 GN=Egr2 PE=1 SV=3
18	P51774	1.92e-73	243	470	0.319	0.368	EGR2_RAT E3 SUMO-protein ligase EGR2 OS=Rattus norvegicus OX=10116 GN=Egr2 PE=2 SV=2
19	A0A0S2Z3U4	9.86e-67	216	201	0.186	0.502	A0A0S2Z3U4_HUMAN Early growth response 2 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=EGR2 PE=1 SV=1
20	Q26452	6.15e-65	221	512	0.184	0.195	Q26452_DROSP Sr protein (Fragment) OS=Drosophila sp. OX=7242 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02389 Cornifin	18	17.0	Cornifin (SPRR) family
2	PF11914 DUF3432	2e-31	119.5	Domain of unknown function (DUF3432)
3	PF11928 DUF3446	6.2e-23	92.3	Early growth response N-terminal domain
4	PF02892 zf-BED	69	14.9	BED zinc finger
5	PF00096 zf-C2H2	3.5e-11	54.0	Zinc finger, C2H2 type
6	PF13894 zf-C2H2_4	1.4e-07	42.7	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	89	14.5	C2H2-type zinc finger
8	PF12171 zf-C2H2_jaz	20	16.8	Zinc-finger double-stranded RNA-binding
9	PF13913 zf-C2HC_2	10	17.4	zinc-finger of a C2HC-type
10	PF13465 zf-H2C2_2	9.4e-13	59.2	Zinc-finger double domain
11	PF13909 zf-H2C2_5	1.9e+02	13.2	C2H2-type zinc-finger domain
12	PF16744 zf-RING_15	56	15.3	KIAA1045 RING finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000239938

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306245	0.999	Proto-oncogene c-Fos
2	9606.ENSP00000336894	0.993	NGFI-A-binding protein 1
3	9606.ENSP00000269305	0.986	Cellular tumor antigen p53
4	9606.ENSP00000303315	0.983	Transcription factor jun-B
5	9606.ENSP00000263253	0.982	Histone acetyltransferase p300
6	9606.ENSP00000300131	0.981	NGFI-A-binding protein 2
7	9606.ENSP00000245919	0.979	Protein fosB
8	9606.ENSP00000389377	0.975	Nuclear factor of activated T-cells, cytoplasmic 1
9	9606.ENSP00000387699	0.972	Cyclic AMP-responsive element-binding protein 1
10	9606.ENSP00000360266	0.969	Transcription factor AP-1
11	9606.ENSP00000263025	0.965	Mitogen-activated protein kinase 3
12	9606.ENSP00000349022	0.964	Activity-regulated cytoskeleton-associated protein
13	9606.ENSP00000265354	0.960	Serum response factor
14	9606.ENSP00000252818	0.959	Transcription factor jun-D
15	9606.ENSP00000334145	0.950	Tissue factor
16	9606.ENSP00000379330	0.949	Nuclear factor of activated T-cells, cytoplasmic 2
17	9606.ENSP00000215832	0.947	Mitogen-activated protein kinase 1
18	9606.ENSP00000354394	0.947	Signal transducer and activator of transcription 1-alpha/beta
19	9606.ENSP00000245414	0.945	Interferon regulatory factor 1
20	9606.ENSP00000249330	0.939	Neurosecretory protein VGF

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0001228	1.000	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.997	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0003682	0.987	chromatin binding
GO:0019899	0.987	enzyme binding
GO:0043167	0.981	ion binding
GO:1990841	0.981	promoter-specific chromatin binding
GO:0035035	0.957	histone acetyltransferase binding
GO:0008270	0.868	zinc ion binding
GO:0010385	0.849	double-stranded methylated DNA binding
GO:0044729	0.538	hemi-methylated DNA-binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0080090	0.986	regulation of primary metabolic process
GO:0009987	0.982	cellular process
GO:0060255	0.982	regulation of macromolecule metabolic process
GO:0050896	0.980	response to stimulus
GO:0031323	0.978	regulation of cellular metabolic process
GO:0048518	0.977	positive regulation of biological process
GO:0051171	0.977	regulation of nitrogen compound metabolic process
GO:0048522	0.972	positive regulation of cellular process
GO:0019219	0.969	regulation of nucleobase-containing compound metabolic process
GO:0010468	0.965	regulation of gene expression
GO:0010556	0.963	regulation of macromolecule biosynthetic process
GO:0031326	0.963	regulation of cellular biosynthetic process
GO:0051252	0.963	regulation of RNA metabolic process
GO:0010604	0.946	positive regulation of macromolecule metabolic process
GO:1903506	0.946	regulation of nucleic acid-templated transcription
GO:0006355	0.909	regulation of DNA-templated transcription
GO:0045935	0.869	positive regulation of nucleobase-containing compound metabolic process
GO:0051716	0.858	cellular response to stimulus
GO:0009891	0.822	positive regulation of biosynthetic process
GO:0010557	0.790	positive regulation of macromolecule biosynthetic process
GO:0051254	0.781	positive regulation of RNA metabolic process
GO:0048519	0.772	negative regulation of biological process
GO:0031328	0.770	positive regulation of cellular biosynthetic process
GO:0045893	0.729	positive regulation of DNA-templated transcription
GO:0032501	0.725	multicellular organismal process
GO:0023052	0.713	signaling
GO:0045944	0.713	positive regulation of transcription by RNA polymerase II
GO:0007154	0.709	cell communication
GO:0007165	0.698	signal transduction
GO:0042221	0.661	response to chemical
GO:0010033	0.630	response to organic substance
GO:0048523	0.609	negative regulation of cellular process
GO:0070887	0.528	cellular response to chemical stimulus
GO:0051246	0.490	regulation of protein metabolic process
GO:0006950	0.469	response to stress
GO:0032502	0.466	developmental process
GO:0071310	0.402	cellular response to organic substance
GO:0010628	0.399	positive regulation of gene expression
GO:0009892	0.396	negative regulation of metabolic process
GO:0010646	0.388	regulation of cell communication
GO:0065009	0.384	regulation of molecular function
GO:0048856	0.382	anatomical structure development
GO:0023051	0.379	regulation of signaling
GO:0007166	0.379	cell surface receptor signaling pathway
GO:0051172	0.374	negative regulation of nitrogen compound metabolic process
GO:0031324	0.366	negative regulation of cellular metabolic process
GO:0008152	0.359	metabolic process
GO:0010605	0.343	negative regulation of macromolecule metabolic process
GO:0071704	0.333	organic substance metabolic process
GO:0048583	0.328	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.980	cytoplasm
GO:0043232	0.546	intracellular non-membrane-bounded organelle
GO:0000785	0.387	chromatin

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]