StarFunc result for job id P18206

User Input

>input (1134 residues)
MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKE
TVQTTEDQILKRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTS
DLLLTFDEAEVRKIIRVCKGILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQ
ELTHQEHRVMLVNSMNTVKELLPVLISAMKIFVTTKNSKNQGIEEALKNRNFTVEKMSAE
INEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQAKGWLRDPSASPGDAGEQAIR
QILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAMQKAQQVSQGL
DVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRA
VANSRPAKAAVHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQD
LLAKCDRVDQLTAQLADLAARGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFS
DTTTPIKLLAVAATAPPDAPNREEVFDERAANFENHSGKLGATAEKAAAVGTANKSTVEG
IQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKNQWIDNVEKMTGLVDEAIDTK
SLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKREVENSEDPKFR
EAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMM
AARQLHDEARKWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQ
PVNQPILAAAQSLHREATKWSSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAK
DIAKASDEVTRLAKEVAKQCTDKRIRTNLLQVCERIPTISTQLKILSTVKATMLGRTNIS
DEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDAGFTLRWVRKTPWYQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:1tr2B	0.891	0.981	0.000	1029	0.898	0.989	1tr2B.pdb.gz
2	AFDB:A0A024QZN4	0.929	0.988	0.000	1066	0.932	0.992	A0A024QZN4.pdb.gz
3	AFDB:A0A0S2I7K2	0.934	0.993	0.000	1066	0.803	0.855	A0A0S2I7K2.pdb.gz	A0A0S2I7K2_DANRE Vinculin OS=Danio rerio OX=7955 GN=vinculin-b PE=1 SV=1
4	AFDB:B3DI32	0.956	0.959	0.000	1131	0.854	0.857	B3DI32.pdb.gz	B3DI32_DANRE Vinculin OS=Danio rerio OX=7955 GN=vcl PE=1 SV=1
5	AFDB:F6NHA0	0.930	0.989	0.000	1066	0.813	0.865	F6NHA0.pdb.gz	F6NHA0_DANRE Vinculin OS=Danio rerio OX=7955 GN=hm:zehn2160 PE=1 SV=1
6	AFDB:P12003	0.988	0.987	0.000	1135	0.937	0.936	P12003.pdb.gz	VINC_CHICK Vinculin OS=Gallus gallus OX=9031 GN=VCL PE=1 SV=4
7	PDB:6nr7A	0.901	0.940	2.080E-103	1086	0.887	0.926	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
8	PDB:6fuyA	0.827	0.973	1.006E-92	961	0.837	0.988	6fuyA.pdb.gz
9	PDB:7ktuA	0.833	0.945	6.307E-85	995	0.877	0.999	7ktuA.pdb.gz
10	AFDB:O46037	0.635	0.737	2.123E-63	961	0.399	0.470	O46037.pdb.gz	VINC_DROME Vinculin OS=Drosophila melanogaster OX=7227 GN=Vinc PE=1 SV=1
11	AFDB:P19826	0.671	0.697	2.730E-61	1090	0.374	0.389	P19826.pdb.gz	VINC_CAEEL Vinculin OS=Caenorhabditis elegans OX=6239 GN=deb-1 PE=1 SV=2
12	AFDB:A0A3B6UES5	0.651	0.863	1.124E-44	846	0.297	0.398	A0A3B6UES5.pdb.gz	VINC_OSCPE Vinculin OS=Oscarella pearsei OX=1940113 GN=VIN1 PE=1 SV=1
13	PDB:6bfiB	0.568	0.790	4.405E-41	806	0.287	0.404	6bfiB.pdb.gz
14	AFDB:Q5U302	0.445	0.549	4.529E-25	908	0.187	0.233	Q5U302.pdb.gz	Q5U302_RAT Catenin alpha 1 OS=Rattus norvegicus OX=10116 GN=Ctnna1 PE=1 SV=1
15	AFDB:P26232	0.427	0.501	5.527E-25	953	0.193	0.230	P26232.pdb.gz	CTNA2_HUMAN Catenin alpha-2 OS=Homo sapiens OX=9606 GN=CTNNA2 PE=1 SV=5
16	PDB:4iggB	0.389	0.552	4.998E-21	771	0.182	0.267	4iggB.pdb.gz
17	PDB:4k1nA	0.343	0.709	2.386E-12	520	0.113	0.246	4k1nA.pdb.gz
18	PDB:6r9tA	0.123	0.079	1.826E-4	2185	0.149	0.077	6r9tA.pdb.gz
19	PDB:7vf2A	0.090	0.087	1.456E-2	1196	0.098	0.093	7vf2A.pdb.gz
20	PDB:6kg7A	0.068	0.049	1.777E-2	1817	0.093	0.058	6kg7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B3DI32	0.0	1922	1131	0.858	0.860	B3DI32_DANRE Vinculin OS=Danio rerio OX=7955 GN=vcl PE=1 SV=1
2	C7EYJ3	0.0	1840	1066	0.861	0.916	C7EYJ3_MELGA Vinculin OS=Meleagris gallopavo OX=9103 PE=2 SV=1
3	F6NHA0	0.0	1730	1066	0.787	0.837	F6NHA0_DANRE Vinculin OS=Danio rerio OX=7955 GN=hm:zehn2160 PE=1 SV=1
4	G1N3C2	0.0	1715	1050	0.809	0.873	G1N3C2_MELGA Vinculin OS=Meleagris gallopavo OX=9103 GN=VCL PE=3 SV=3
5	P12003	0.0	2060	1135	0.937	0.937	VINC_CHICK Vinculin OS=Gallus gallus OX=9031 GN=VCL PE=1 SV=4
6	P18206	0.0	2313	1134	1.000	1.000	VINC_HUMAN Vinculin OS=Homo sapiens OX=9606 GN=VCL PE=1 SV=4
7	P85972	0.0	2026	1066	0.899	0.956	VINC_RAT Vinculin OS=Rattus norvegicus OX=10116 GN=Vcl PE=1 SV=1
8	Q64727	0.0	2035	1066	0.902	0.960	VINC_MOUSE Vinculin OS=Mus musculus OX=10090 GN=Vcl PE=1 SV=4
9	V9HWK2	0.0	2313	1134	1.000	1.000	V9HWK2_HUMAN Vinculin OS=Homo sapiens OX=9606 GN=HEL114 PE=2 SV=1
10	Q6LDD0	6.92e-121	371	181	0.156	0.978	Q6LDD0_CHICK Vinculin (Fragment) OS=Gallus gallus OX=9031 GN=vinculin PE=3 SV=1
11	O46037	4.57e-117	387	961	0.213	0.252	VINC_DROME Vinculin OS=Drosophila melanogaster OX=7227 GN=Vinc PE=1 SV=1
12	P19826	6.59e-99	340	1090	0.196	0.204	VINC_CAEEL Vinculin OS=Caenorhabditis elegans OX=6239 GN=deb-1 PE=1 SV=2
13	A0A0S2I7K2	1.03e-93	325	1066	0.139	0.148	A0A0S2I7K2_DANRE Vinculin OS=Danio rerio OX=7955 GN=vinculin-b PE=1 SV=1
14	A0A3B6UES5	7.19e-61	226	846	0.120	0.161	VINC_OSCPE Vinculin OS=Oscarella pearsei OX=1940113 GN=VIN1 PE=1 SV=1
15	P26232	6.98e-23	108	953	0.109	0.130	CTNA2_HUMAN Catenin alpha-2 OS=Homo sapiens OX=9606 GN=CTNNA2 PE=1 SV=5
16	Q61301	2.49e-22	106	953	0.107	0.127	CTNA2_MOUSE Catenin alpha-2 OS=Mus musculus OX=10090 GN=Ctnna2 PE=1 SV=3
17	P30997	8.57e-22	104	906	0.108	0.135	CTNA2_CHICK Catenin alpha-2 OS=Gallus gallus OX=9031 GN=CTNNA2 PE=1 SV=1
18	G3XAM7	1.01e-20	100	841	0.077	0.103	G3XAM7_HUMAN Catenin (Cadherin-associated protein), alpha 1, 102kDa, isoform CRA_a OS=Homo sapiens OX=9606 GN=CTNNA1 PE=1 SV=1
19	Q5U302	2.65e-20	99.8	908	0.077	0.096	Q5U302_RAT Catenin alpha 1 OS=Rattus norvegicus OX=10116 GN=Ctnna1 PE=1 SV=1
20	P26231	3.08e-20	99.8	906	0.077	0.096	CTNA1_MOUSE Catenin alpha-1 OS=Mus musculus OX=10090 GN=Ctnna1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14355 Abi_C	45	15.6	Abortive infection C-terminus
2	PF00619 CARD	4.4e+02	12.3	Caspase recruitment domain
3	PF11367 DUF3168	3.8e+02	12.7	Protein of unknown function (DUF3168)
4	PF12205 GIT1_C	1.2e+02	14.3	G protein-coupled receptor kinase-interacting protein 1 C term
5	PF01044 Vinculin	0	1666.3	Vinculin family
6	PF19916 VMAP-M0	43	16.1	vWA-MoxR associated protein middle region 0

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000211998

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261769	0.999	Cadherin-1
2	9606.ENSP00000267257	0.999	Paxillin
3	9606.ENSP00000316029	0.999	Talin-1
4	9606.ENSP00000344456	0.999	Catenin beta-1
5	9606.ENSP00000240123	0.998	Vinexin
6	9606.ENSP00000324422	0.998	Zyxin
7	9606.ENSP00000360293	0.998	Sorbin and SH3 domain-containing protein 1
8	9606.ENSP00000377941	0.998	Alpha-actinin-1
9	9606.ENSP00000391669	0.998	Breast cancer anti-estrogen resistance protein 1
10	9606.ENSP00000304669	0.997	Catenin alpha-1
11	9606.ENSP00000341189	0.996	Focal adhesion kinase 1
12	9606.ENSP00000252699	0.995	Alpha-actinin-4
13	9606.ENSP00000245932	0.994	Vasodilator-stimulated phosphoprotein
14	9606.ENSP00000379350	0.994	Integrin beta-1
15	9606.ENSP00000355645	0.993	Actin, alpha skeletal muscle
16	9606.ENSP00000362680	0.993	Proto-oncogene tyrosine-protein kinase Src
17	9606.ENSP00000453508	0.993	Talin-2
18	9606.ENSP00000293677	0.991	Ribonucleoprotein PTB-binding 1
19	9606.ENSP00000400175	0.989	Transforming protein RhoA
20	9606.ENSP00000027335	0.988	Cadherin-17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.999	cytoskeletal protein binding
GO:0045296	0.998	cadherin binding
GO:0045294	0.940	alpha-catenin binding
GO:0019899	0.893	enzyme binding
GO:0003779	0.820	actin binding
GO:0042802	0.808	identical protein binding
GO:0044877	0.719	protein-containing complex binding
GO:0008013	0.713	beta-catenin binding
GO:0017166	0.323	vinculin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.993	biological regulation
GO:0048856	0.986	anatomical structure development
GO:0071840	0.984	cellular component organization or biogenesis
GO:0016043	0.968	cellular component organization
GO:0044085	0.965	cellular component biogenesis
GO:0032501	0.955	multicellular organismal process
GO:0022607	0.946	cellular component assembly
GO:0030154	0.935	cell differentiation
GO:0009653	0.932	anatomical structure morphogenesis
GO:0050789	0.920	regulation of biological process
GO:0050794	0.913	regulation of cellular process
GO:0007275	0.911	multicellular organism development
GO:0065008	0.865	regulation of biological quality
GO:0048731	0.863	system development
GO:0048513	0.840	animal organ development
GO:0030029	0.825	actin filament-based process
GO:0072359	0.811	circulatory system development
GO:0030036	0.805	actin cytoskeleton organization
GO:0048468	0.769	cell development
GO:0007155	0.761	cell adhesion
GO:0050896	0.757	response to stimulus
GO:0042391	0.661	regulation of membrane potential
GO:0061061	0.654	muscle structure development
GO:0007507	0.594	heart development
GO:0097435	0.572	supramolecular fiber organization
GO:0003008	0.565	system process
GO:0003170	0.517	heart valve development
GO:0001508	0.501	action potential
GO:0070925	0.501	organelle assembly
GO:0003013	0.482	circulatory system process
GO:0086001	0.482	cardiac muscle cell action potential
GO:0032989	0.482	cellular component morphogenesis
GO:0003181	0.478	atrioventricular valve morphogenesis
GO:0048646	0.446	anatomical structure formation involved in morphogenesis
GO:0048519	0.406	negative regulation of biological process
GO:0048518	0.406	positive regulation of biological process
GO:0051128	0.397	regulation of cellular component organization
GO:0048522	0.396	positive regulation of cellular process
GO:0048523	0.392	negative regulation of cellular process
GO:0040012	0.301	regulation of locomotion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005925	0.986	focal adhesion
GO:0016020	0.975	membrane
GO:0071944	0.950	cell periphery
GO:0005886	0.942	plasma membrane
GO:0005829	0.941	cytosol
GO:0043229	0.827	intracellular organelle
GO:0043227	0.760	membrane-bounded organelle
GO:0005911	0.732	cell-cell junction
GO:0043231	0.722	intracellular membrane-bounded organelle
GO:0005912	0.503	adherens junction
GO:0043232	0.430	intracellular non-membrane-bounded organelle
GO:0031981	0.337	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]