StarFunc result for job id P18428

User Input

>input (481 residues)
MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLP
DFTGDLRIPHVGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRK
SFFKLQGSFDVSVKGISISVNLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNL
FHNQIESKFQKVLESRICEMIQKSVSSDLQPYLQTLPVTTEIDSFADIDYSLVEAPRATA
QMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFAISDYVFNTASLVYHEEGYLN
FSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLNFSPGNLSVDP
YMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN
AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMR
V

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18428	1.000	1.000	2.767E-97	481	1.000	1.000	P18428.pdb.gz	LBP_HUMAN Lipopolysaccharide-binding protein OS=Homo sapiens OX=9606 GN=LBP PE=1 SV=3
2	AFDB:Q63313	0.936	0.936	8.427E-79	481	0.674	0.674	Q63313.pdb.gz	LBP_RAT Lipopolysaccharide-binding protein OS=Rattus norvegicus OX=10116 GN=Lbp PE=2 SV=1
3	AFDB:Q61805	0.971	0.971	2.599E-76	481	0.676	0.676	Q61805.pdb.gz	LBP_MOUSE Lipopolysaccharide-binding protein OS=Mus musculus OX=10090 GN=Lbp PE=1 SV=2
4	AFDB:P17454	0.945	0.943	9.097E-75	482	0.688	0.687	P17454.pdb.gz	LBP_RABIT Lipopolysaccharide-binding protein OS=Oryctolagus cuniculus OX=9986 GN=LBP PE=1 SV=2
5	AFDB:P17213	0.907	0.897	8.856E-66	487	0.435	0.429	P17213.pdb.gz	BPI_HUMAN Bactericidal permeability-increasing protein OS=Homo sapiens OX=9606 GN=BPI PE=1 SV=4
6	PDB:4m4dA	0.689	0.734	1.310E-65	448	0.634	0.681	4m4dA.pdb.gz
7	AFDB:Q6AXU0	0.922	0.920	4.839E-65	482	0.397	0.396	Q6AXU0.pdb.gz	BPI_RAT Bactericidal permeability-increasing protein OS=Rattus norvegicus OX=10116 GN=Bpi PE=2 SV=1
8	AFDB:Q67E05	0.921	0.917	1.144E-62	483	0.383	0.381	Q67E05.pdb.gz	BPI_MOUSE Bactericidal permeability-increasing protein OS=Mus musculus OX=10090 GN=Bpi PE=1 SV=1
9	PDB:1bp1A	0.886	0.932	1.144E-61	456	0.426	0.450	1bp1A.pdb.gz
10	AFDB:Q9MAU5	0.859	0.847	9.554E-44	488	0.206	0.203	Q9MAU5.pdb.gz	Y1049_ARATH Putative BPI/LBP family protein At1g04970 OS=Arabidopsis thaliana OX=3702 GN=At1g04970 PE=2 SV=1
11	AFDB:Q8WMN7	0.831	0.807	3.719E-42	496	0.239	0.232	Q8WMN7.pdb.gz	Q8WMN7_PIG Plasma phospholipid transfer protein OS=Sus scrofa OX=9823 GN=PLTP PE=2 SV=1
12	AFDB:P55065	0.830	0.811	4.361E-42	493	0.245	0.239	P55065.pdb.gz	PLTP_MOUSE Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1
13	PDB:4ewsA	0.623	0.633	3.503E-33	472	0.195	0.199	4ewsA.pdb.gz	Crystal structures of cholesteryl ester transfer protein in complex with inhibitors.
14	PDB:3h4zA	0.239	0.208	8.576E-7	568	0.046	0.039	3h4zA.pdb.gz	The structure of the dust mite allergen Der p 7 reveals similarities to innate immune proteins.
15	PDB:6baqF	0.181	0.345	3.712E-5	211	0.046	0.104	6baqF.pdb.gz
16	PDB:3zpmA	0.225	0.425	3.448E-4	211	0.073	0.166	3zpmA.pdb.gz
17	PDB:4kegA	0.181	0.166	9.451E-4	535	0.052	0.047	4kegA.pdb.gz	The Lipid Ligands of the SPLUNC1 Protein
18	PDB:6h03C	0.054	0.052	2.975E-2	513	0.067	0.062	6h03C.pdb.gz
19	PDB:7nydE	0.058	0.058	3.137E-2	484	0.069	0.068	7nydE.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
20	PDB:7r5jK0	0.076	0.046	3.489E-2	1086	0.114	0.051	7r5jK0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P17454	0.0	653	482	0.657	0.656	LBP_RABIT Lipopolysaccharide-binding protein OS=Oryctolagus cuniculus OX=9986 GN=LBP PE=1 SV=2
2	P18428	0.0	979	481	1.000	1.000	LBP_HUMAN Lipopolysaccharide-binding protein OS=Homo sapiens OX=9606 GN=LBP PE=1 SV=3
3	Q61805	0.0	668	481	0.657	0.657	LBP_MOUSE Lipopolysaccharide-binding protein OS=Mus musculus OX=10090 GN=Lbp PE=1 SV=2
4	Q63313	0.0	651	481	0.659	0.659	LBP_RAT Lipopolysaccharide-binding protein OS=Rattus norvegicus OX=10116 GN=Lbp PE=2 SV=1
5	P17213	6.14e-143	420	487	0.437	0.431	BPI_HUMAN Bactericidal permeability-increasing protein OS=Homo sapiens OX=9606 GN=BPI PE=1 SV=4
6	Q6AXU0	1.81e-128	383	482	0.399	0.398	BPI_RAT Bactericidal permeability-increasing protein OS=Rattus norvegicus OX=10116 GN=Bpi PE=2 SV=1
7	Q67E05	4.67e-119	359	483	0.380	0.379	BPI_MOUSE Bactericidal permeability-increasing protein OS=Mus musculus OX=10090 GN=Bpi PE=1 SV=1
8	P55065	1.30e-36	143	493	0.237	0.231	PLTP_MOUSE Phospholipid transfer protein OS=Mus musculus OX=10090 GN=Pltp PE=1 SV=1
9	P55058	1.85e-36	142	493	0.231	0.225	PLTP_HUMAN Phospholipid transfer protein OS=Homo sapiens OX=9606 GN=PLTP PE=1 SV=1
10	Q8WMN7	8.68e-34	135	496	0.233	0.226	Q8WMN7_PIG Plasma phospholipid transfer protein OS=Sus scrofa OX=9823 GN=PLTP PE=2 SV=1
11	F4JDK0	1.28e-29	124	722	0.225	0.150	F4JDK0_ARATH Lipid-binding serum glycoprotein family protein OS=Arabidopsis thaliana OX=3702 GN=LBR-2 PE=1 SV=1
12	Q9MAU5	2.65e-28	119	488	0.220	0.217	Y1049_ARATH Putative BPI/LBP family protein At1g04970 OS=Arabidopsis thaliana OX=3702 GN=At1g04970 PE=2 SV=1
13	P22687	7.63e-19	91.3	497	0.162	0.157	CETP_RABIT Cholesteryl ester transfer protein (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=CETP PE=1 SV=1
14	P11597	4.37e-18	89.0	493	0.164	0.160	CETP_HUMAN Cholesteryl ester transfer protein OS=Homo sapiens OX=9606 GN=CETP PE=1 SV=2
15	G3HIK4	5.03e-18	89.0	492	0.193	0.189	CETP_CRIGR Cholesteryl ester transfer protein OS=Cricetulus griseus OX=10029 GN=CETP PE=3 SV=2
16	P47896	3.44e-17	86.3	493	0.164	0.160	CETP_MACFA Cholesteryl ester transfer protein OS=Macaca fascicularis OX=9541 GN=CETP PE=1 SV=1
17	Q8N4F0	3.30e-12	70.5	458	0.229	0.240	BPIB2_HUMAN BPI fold-containing family B member 2 OS=Homo sapiens OX=9606 GN=BPIFB2 PE=1 SV=2
18	P59826	4.03e-10	64.3	472	0.156	0.159	BPIB3_HUMAN BPI fold-containing family B member 3 OS=Homo sapiens OX=9606 GN=BPIFB3 PE=1 SV=3
19	P59827	1.03e-09	63.2	614	0.179	0.140	BPIB4_HUMAN BPI fold-containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=2 SV=2
20	A0A669KBJ0	1.12e-09	63.2	736	0.179	0.117	A0A669KBJ0_HUMAN BPI fold containing family B member 4 OS=Homo sapiens OX=9606 GN=BPIFB4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01273 LBP_BPI_CETP	1.4e-45	166.4	LBP / BPI / CETP family, N-terminal domain
2	PF02886 LBP_BPI_CETP_C	5.7e-100	345.2	LBP / BPI / CETP family, C-terminal domain
3	PF09650 PHA_gran_rgn	5.8	18.6	Putative polyhydroxyalkanoic acid system protein (PHA_gran_rgn)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000217407

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000304236	0.985	Monocyte differentiation antigen CD14
2	9606.ENSP00000363089	0.983	Toll-like receptor 4
3	9606.ENSP00000284818	0.981	Lymphocyte antigen 96
4	9606.ENSP00000385675	0.964	Interleukin-6
5	9606.ENSP00000384906	0.944	Serum amyloid A-1 protein
6	9606.ENSP00000412237	0.944	Interleukin-10
7	9606.ENSP00000362108	0.923	Neutrophil gelatinase-associated lipocalin
8	9606.ENSP00000344192	0.920	Interleukin-17A
9	9606.ENSP00000264657	0.917	Signal transducer and activator of transcription 3
10	9606.ENSP00000361405	0.914	Matrix metalloproteinase-9
11	9606.ENSP00000218388	0.913	Metalloproteinase inhibitor 1
12	9606.ENSP00000478570	0.910	Vascular endothelial growth factor A
13	9606.ENSP00000219070	0.908	72 kDa type IV collagenase
14	9606.ENSP00000221930	0.908	Transforming growth factor beta-1
15	9606.ENSP00000222390	0.907	Hepatocyte growth factor
16	9606.ENSP00000262865	0.906	Bactericidal permeability-increasing protein
17	9606.ENSP00000299855	0.906	Stromelysin-1
18	9606.ENSP00000384092	0.906	Pro-opiomelanocortin
19	9606.ENSP00000322788	0.903	Interstitial collagenase
20	9606.ENSP00000337432	0.901	Interleukin-17F

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001530	1.000	lipopolysaccharide binding
GO:0005515	0.998	protein binding
GO:0005102	0.871	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009605	0.995	response to external stimulus
GO:0051716	0.995	cellular response to stimulus
GO:0010468	0.995	regulation of gene expression
GO:0010604	0.995	positive regulation of macromolecule metabolic process
GO:0002682	0.993	regulation of immune system process
GO:0050794	0.992	regulation of cellular process
GO:0002275	0.991	myeloid cell activation involved in immune response
GO:0042116	0.990	macrophage activation
GO:0002237	0.990	response to molecule of bacterial origin
GO:0032760	0.989	positive regulation of tumor necrosis factor production
GO:0071216	0.988	cellular response to biotic stimulus
GO:0098542	0.985	defense response to other organism
GO:0032103	0.984	positive regulation of response to external stimulus
GO:0048522	0.983	positive regulation of cellular process
GO:0042742	0.983	defense response to bacterium
GO:0031347	0.967	regulation of defense response
GO:0071219	0.958	cellular response to molecule of bacterial origin
GO:0002684	0.957	positive regulation of immune system process
GO:0071222	0.951	cellular response to lipopolysaccharide
GO:0002526	0.950	acute inflammatory response
GO:0048519	0.944	negative regulation of biological process
GO:0031349	0.944	positive regulation of defense response
GO:0050829	0.942	defense response to Gram-negative bacterium
GO:0050778	0.941	positive regulation of immune response
GO:0002831	0.933	regulation of response to biotic stimulus
GO:0007154	0.928	cell communication
GO:0002833	0.924	positive regulation of response to biotic stimulus
GO:0007165	0.921	signal transduction
GO:0043030	0.910	regulation of macrophage activation
GO:0032677	0.901	regulation of interleukin-8 production
GO:0045088	0.890	regulation of innate immune response
GO:0045089	0.880	positive regulation of innate immune response
GO:0032675	0.877	regulation of interleukin-6 production
GO:0023051	0.861	regulation of signaling
GO:0010646	0.861	regulation of cell communication
GO:0001818	0.849	negative regulation of cytokine production
GO:0009966	0.839	regulation of signal transduction
GO:0002253	0.790	activation of immune response
GO:1903556	0.765	negative regulation of tumor necrosis factor superfamily cytokine production
GO:0002218	0.719	activation of innate immune response
GO:0007166	0.717	cell surface receptor signaling pathway
GO:0032720	0.676	negative regulation of tumor necrosis factor production
GO:0009967	0.607	positive regulation of signal transduction
GO:0031323	0.510	regulation of cellular metabolic process
GO:0002757	0.506	immune response-activating signaling pathway
GO:0048523	0.502	negative regulation of cellular process
GO:0032502	0.485	developmental process
GO:0048856	0.484	anatomical structure development
GO:0045087	0.473	innate immune response
GO:0002758	0.448	innate immune response-activating signaling pathway
GO:0002696	0.417	positive regulation of leukocyte activation
GO:0032879	0.413	regulation of localization
GO:0051049	0.352	regulation of transport
GO:0062207	0.343	regulation of pattern recognition receptor signaling pathway
GO:0050830	0.337	defense response to Gram-positive bacterium
GO:0006953	0.321	acute-phase response
GO:0051179	0.320	localization
GO:0051171	0.305	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0031982	0.987	vesicle
GO:0012505	0.939	endomembrane system
GO:0070062	0.878	extracellular exosome
GO:0043231	0.777	intracellular membrane-bounded organelle
GO:0005737	0.713	cytoplasm
GO:0009986	0.551	cell surface
GO:0070013	0.439	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]