StarFunc result for job id P18433

User Input

>input (802 residues)
MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLS
VAPTFSPNITLGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEP
WEGNSSTAATTPETFPPSGNSDSKDRRDETPIIAVMVALSSLLVIVFIIIVLYMLRFKKY
KQAGSHSNSFRLSNGRTEDVEPQSVPLLARSPSTNRKYPPLPVDKLEEEINRRMADDNKL
FREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHSRVHLTPVEGVPDSDYINASF
INGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKCAQYWPDQGCW
TYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGM
LKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQ
RCQMVQTDMQYVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKL
TSIKIQNDKMRTGNLPANMKKNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQK
DSYIASQGPLLHTIEDFWRMIWEWKSCSIVMLTELEERGQEKCAQYWPSDGLVSYGDITV
ELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEVGIPSDGKGMISIIAAVQKQQ
QQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQRPHMVQTLEQ
YEFCYKVVQEYIDAFSDYANFK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18052	0.769	0.745	0.000	829	0.945	0.914	P18052.pdb.gz	PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus OX=10090 GN=Ptpra PE=1 SV=3
2	AFDB:P18433	1.000	1.000	0.000	802	1.000	1.000	P18433.pdb.gz	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3
3	AFDB:P23469	0.724	0.828	1.143E-103	700	0.581	0.666	P23469.pdb.gz	PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens OX=9606 GN=PTPRE PE=1 SV=1
4	AFDB:Q1MTF9	0.717	0.848	6.403E-101	677	0.547	0.648	Q1MTF9.pdb.gz	Q1MTF9_DANRE Receptor-type tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=si:dkey-46n18.4 PE=3 SV=1
5	AFDB:A0A0H2UKT5	0.714	0.302	1.750E-84	1914	0.393	0.165	A0A0H2UKT5.pdb.gz
6	AFDB:B0V2N1	0.713	0.304	2.674E-83	1907	0.374	0.157	B0V2N1.pdb.gz	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
7	AFDB:P10586	0.717	0.304	4.368E-83	1907	0.393	0.165	P10586.pdb.gz	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
8	AFDB:Q13332	0.717	0.300	1.166E-82	1948	0.378	0.156	Q13332.pdb.gz	PTPRS_HUMAN Receptor-type tyrosine-protein phosphatase S OS=Homo sapiens OX=9606 GN=PTPRS PE=1 SV=3
9	AFDB:F1QJW2	0.715	0.301	1.531E-82	1918	0.367	0.153	F1QJW2.pdb.gz
10	AFDB:A4IFW2	0.715	0.303	1.803E-82	1909	0.385	0.162	A4IFW2.pdb.gz	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
11	PDB:4gwfA	0.330	0.525	5.575E-28	497	0.150	0.241	4gwfA.pdb.gz
12	PDB:5xzrA	0.335	0.510	5.215E-27	519	0.151	0.233	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
13	PDB:3ps5A	0.334	0.498	6.142E-27	529	0.140	0.212	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
14	PDB:6krwA	0.319	0.794	1.326E-22	306	0.118	0.310	6krwA.pdb.gz
15	PDB:3m4uA	0.294	0.789	1.167E-16	285	0.102	0.288	3m4uA.pdb.gz
16	PDB:4ercA	0.145	0.680	6.801E-4	150	0.039	0.207	4ercA.pdb.gz	New Aspects of the Phosphatase VHZ Revealed by a High-Resolution Structure with Vanadate and Substrate Screening.
17	PDB:5xjvB	0.146	0.554	1.917E-3	171	0.025	0.117	5xjvB.pdb.gz
18	PDB:3s4oA	0.140	0.540	3.492E-3	163	0.035	0.172	3s4oA.pdb.gz
19	PDB:7jvxA	0.149	0.328	5.705E-3	314	0.041	0.105	7jvxA.pdb.gz
20	PDB:2gwoC	0.156	0.585	8.356E-3	174	0.020	0.092	2gwoC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A8I5ZQN2	618	1506	0.380	0.203	A0A8I5ZQN2_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
2	A0A8I6A1V1	623	1912	0.379	0.159	A0A8I6A1V1_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
3	A0A8I6A6R5	619	1920	0.382	0.159	A0A8I6A6R5_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
4	A0A8I6A789	618	1505	0.382	0.203	A0A8I6A789_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
5	A0A8I6AEM0	623	1897	0.379	0.160	A0A8I6AEM0_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=1
6	A2A8L5	623	1898	0.370	0.156	PTPRF_MOUSE Receptor-type tyrosine-protein phosphatase F OS=Mus musculus OX=10090 GN=Ptprf PE=1 SV=1
7	A4IFW2	615	1909	0.367	0.154	PTPRF_DANRE Receptor-type tyrosine-protein phosphatase F OS=Danio rerio OX=7955 GN=ptprf PE=2 SV=1
8	B0V2N1	610	1907	0.389	0.164	PTPRS_MOUSE Receptor-type tyrosine-protein phosphatase S OS=Mus musculus OX=10090 GN=Ptprs PE=1 SV=1
9	B2GV87	956	699	0.561	0.644	PTPRE_RAT Receptor-type tyrosine-protein phosphatase epsilon OS=Rattus norvegicus OX=10116 GN=Ptpre PE=2 SV=1
10	E7EZG7	953	681	0.560	0.659	E7EZG7_DANRE Receptor-type tyrosine-protein phosphatase OS=Danio rerio OX=7955 GN=ptprea PE=3 SV=1
11	F1NWE3	611	1516	0.394	0.208	PTPRS_CHICK Receptor-type tyrosine-protein phosphatase S OS=Gallus gallus OX=9031 GN=PTPRS PE=1 SV=3
12	F1QE38	1267	831	0.756	0.729	F1QE38_DANRE Receptor-type tyrosine-protein phosphatase alpha OS=Danio rerio OX=7955 GN=RPTP[a] PE=1 SV=1
13	H9CWQ2	624	1894	0.372	0.157	H9CWQ2_DANRE protein-tyrosine-phosphatase OS=Danio rerio OX=7955 GN=LAR PE=2 SV=1
14	M0RB22	619	1899	0.382	0.161	M0RB22_RAT protein-tyrosine-phosphatase OS=Rattus norvegicus OX=10116 GN=Ptprd PE=1 SV=3
15	P10586	620	1907	0.372	0.156	PTPRF_HUMAN Receptor-type tyrosine-protein phosphatase F OS=Homo sapiens OX=9606 GN=PTPRF PE=1 SV=2
16	P16621	598	2029	0.359	0.142	LAR_DROME Tyrosine-protein phosphatase Lar OS=Drosophila melanogaster OX=7227 GN=Lar PE=1 SV=2
17	P18052	1573	829	0.948	0.917	PTPRA_MOUSE Receptor-type tyrosine-protein phosphatase alpha OS=Mus musculus OX=10090 GN=Ptpra PE=1 SV=3
18	P18433	1681	802	1.000	1.000	PTPRA_HUMAN Receptor-type tyrosine-protein phosphatase alpha OS=Homo sapiens OX=9606 GN=PTPRA PE=1 SV=3
19	P23468	618	1912	0.378	0.158	PTPRD_HUMAN Receptor-type tyrosine-protein phosphatase delta OS=Homo sapiens OX=9606 GN=PTPRD PE=1 SV=2
20	P23469	956	700	0.562	0.644	PTPRE_HUMAN Receptor-type tyrosine-protein phosphatase epsilon OS=Homo sapiens OX=9606 GN=PTPRE PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00782 DSPc	5.4e-06	37.7	Dual specificity phosphatase, catalytic domain
2	PF14566 PTPlike_phytase	0.0016	30.0	Inositol hexakisphosphate
3	PF00102 Y_phosphatase	5e-161	545.1	Protein-tyrosine phosphatase
4	PF03162 Y_phosphatase2	5.3e+02	11.6	Tyrosine phosphatase family
5	PF13350 Y_phosphatase3	1.3e-05	36.9	Tyrosine phosphatase family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000369756

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362680	0.998	Proto-oncogene tyrosine-protein kinase Src
2	9606.ENSP00000376345	0.997	Growth factor receptor-bound protein 2
3	9606.ENSP00000346671	0.953	Tyrosine-protein kinase Fyn
4	9606.ENSP00000407586	0.928	GTPase HRas
5	9606.ENSP00000303830	0.916	Insulin receptor
6	9606.ENSP00000380432	0.916	Insulin
7	9606.ENSP00000256078	0.912	GTPase KRas
8	9606.ENSP00000358548	0.910	GTPase NRas
9	9606.ENSP00000480132	0.849	Neural cell adhesion molecule 1
10	9606.ENSP00000349932	0.825	Receptor-type tyrosine-protein phosphatase S
11	9606.ENSP00000280362	0.822	6-pyruvoyl tetrahydrobiopterin synthase
12	9606.ENSP00000256509	0.773	Neural cell adhesion molecule L1-like protein
13	9606.ENSP00000217173	0.772	RING finger protein 37
14	9606.ENSP00000215832	0.756	Mitogen-activated protein kinase 1
15	9606.ENSP00000229795	0.745	Mitogen-activated protein kinase 14
16	9606.ENSP00000417183	0.739	Dual specificity protein phosphatase 7
17	9606.ENSP00000357129	0.716	Spectrin alpha chain, erythrocytic 1
18	9606.ENSP00000233154	0.713	Cytoplasmic protein NCK2
19	9606.ENSP00000279488	0.704	Dual specificity protein phosphatase 6
20	9606.ENSP00000433109	0.701	Potassium voltage-gated channel subfamily A member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004725	1.000	protein tyrosine phosphatase activity
GO:0004888	0.632	transmembrane signaling receptor activity
GO:0005001	0.620	transmembrane receptor protein tyrosine phosphatase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.981	regulation of cellular process
GO:0007275	0.968	multicellular organism development
GO:0009987	0.963	cellular process
GO:0048731	0.929	system development
GO:0019222	0.921	regulation of metabolic process
GO:0051174	0.898	regulation of phosphorus metabolic process
GO:0019220	0.890	regulation of phosphate metabolic process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0051171	0.877	regulation of nitrogen compound metabolic process
GO:0080090	0.876	regulation of primary metabolic process
GO:0051246	0.872	regulation of protein metabolic process
GO:0001932	0.859	regulation of protein phosphorylation
GO:0060027	0.845	convergent extension involved in gastrulation
GO:0045859	0.843	regulation of protein kinase activity
GO:0048518	0.822	positive regulation of biological process
GO:0050896	0.821	response to stimulus
GO:0048522	0.775	positive regulation of cellular process
GO:0008152	0.735	metabolic process
GO:0051240	0.715	positive regulation of multicellular organismal process
GO:0045685	0.694	regulation of glial cell differentiation
GO:0051716	0.684	cellular response to stimulus
GO:0071704	0.641	organic substance metabolic process
GO:0044237	0.619	cellular metabolic process
GO:2000026	0.605	regulation of multicellular organismal development
GO:0051960	0.603	regulation of nervous system development
GO:0044238	0.590	primary metabolic process
GO:0006807	0.577	nitrogen compound metabolic process
GO:0060284	0.572	regulation of cell development
GO:0007154	0.569	cell communication
GO:0048519	0.566	negative regulation of biological process
GO:0023052	0.565	signaling
GO:0014013	0.563	regulation of gliogenesis
GO:0007165	0.555	signal transduction
GO:0060041	0.541	retina development in camera-type eye
GO:0036211	0.529	protein modification process
GO:0006796	0.528	phosphate-containing compound metabolic process
GO:0051094	0.506	positive regulation of developmental process
GO:0048523	0.488	negative regulation of cellular process
GO:0014015	0.484	positive regulation of gliogenesis
GO:0045687	0.446	positive regulation of glial cell differentiation
GO:0023051	0.432	regulation of signaling
GO:0010646	0.432	regulation of cell communication
GO:0048583	0.408	regulation of response to stimulus
GO:0009966	0.363	regulation of signal transduction
GO:0007166	0.315	cell surface receptor signaling pathway
GO:0042221	0.301	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0043229	0.976	intracellular organelle
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:0005737	0.889	cytoplasm
GO:0005829	0.532	cytosol
GO:1903561	0.340	extracellular vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:10684	1.000	H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate
EC:3.1.3.48	1.000	protein-tyrosine-phosphatase.

[back to server]