StarFunc result for job id P18509

User Input

>input (176 residues)
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPG
AGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGG
AGDDAEPLSKRHSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18509	1.000	1.000	5.534E-27	176	1.000	1.000	P18509.pdb.gz	PACA_HUMAN Pituitary adenylate cyclase-activating polypeptide OS=Homo sapiens OX=9606 GN=ADCYAP1 PE=1 SV=3
2	AFDB:P16613	0.599	0.599	7.670E-17	176	0.824	0.824	P16613.pdb.gz	PACA_SHEEP Pituitary adenylate cyclase-activating polypeptide OS=Ovis aries OX=9940 GN=ADCYAP1 PE=1 SV=1
3	AFDB:P41534	0.292	0.292	2.281E-12	175	0.608	0.611	P41534.pdb.gz	PACA_CHICK Glucagon family neuropeptides OS=Gallus gallus OX=9031 GN=ADCYAP1 PE=1 SV=2
4	AFDB:Q98TU3	0.333	0.335	8.334E-11	175	0.545	0.549	Q98TU3.pdb.gz	Q98TU3_DANRE Adcyap1b protein OS=Danio rerio OX=7955 GN=PACAP2 PE=1 SV=1
5	AFDB:Q5XJ29	0.214	0.192	1.698E-7	199	0.443	0.392	Q5XJ29.pdb.gz	Q5XJ29_DANRE Adcyap1a protein OS=Danio rerio OX=7955 GN=GRF-PACAP PE=2 SV=1
6	AFDB:Q86YS3	0.191	0.061	4.302E-1	637	0.108	0.030	Q86YS3.pdb.gz	RFIP4_HUMAN Rab11 family-interacting protein 4 OS=Homo sapiens OX=9606 GN=RAB11FIP4 PE=1 SV=1
7	AFDB:Q96HY6	0.204	0.121	5.316E-1	314	0.153	0.086	Q96HY6.pdb.gz	DDRGK_HUMAN DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=2
8	AFDB:Q9SKA2	0.197	0.099	6.121E-1	385	0.165	0.075	Q9SKA2.pdb.gz	Q9SKA2_ARATH Late embryogenesis abundant protein (LEA) family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22600 PE=1 SV=1
9	AFDB:Q54ER9	0.188	0.067	9.347E-1	602	0.097	0.028	Q54ER9.pdb.gz	DIMB_DICDI Basic-leucine zipper transcription factor B OS=Dictyostelium discoideum OX=44689 GN=dimB PE=1 SV=1
10	AFDB:Q9NVC6	0.203	0.063	1.003	651	0.159	0.043	Q9NVC6.pdb.gz	MED17_HUMAN Mediator of RNA polymerase II transcription subunit 17 OS=Homo sapiens OX=9606 GN=MED17 PE=1 SV=2
11	PDB:5zwmY	0.161	0.288	4.994	89	0.085	0.169	5zwmY.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
12	PDB:7dvqR	0.130	0.102	6.172	241	0.114	0.083	7dvqR.pdb.gz	Structure of the activated human minor spliceosome.
13	PDB:7mq9SI	0.198	0.045	7.107	844	0.125	0.026	7mq9SI.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:5gm6W	0.142	0.229	7.626	104	0.102	0.173	5gm6W.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
15	PDB:7ktsD	0.168	0.138	7.626	219	0.119	0.096	7ktsD.pdb.gz
16	PDB:1ezvG	0.153	0.248	8.184	93	0.074	0.140	1ezvG.pdb.gz	Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment.
17	PDB:5y88V	0.162	0.285	8.184	91	0.057	0.110	5y88V.pdb.gz	Structure of an Intron Lariat Spliceosome from Saccharomyces cerevisiae
18	PDB:7dgqg	0.163	0.166	8.184	173	0.068	0.069	7dgqg.pdb.gz	A Dynamic Substrate Pool Revealed by cryo-EM of a Lipid-Preserved Respiratory Supercomplex.
19	PDB:1ocuA	0.106	0.138	9.424	134	0.028	0.037	1ocuA.pdb.gz	Crystal structure of the yeast Phox homology (PX) domain protein Grd19p complexed to phosphatidylinositol-3-phosphate.
20	PDB:5wlcNB	0.135	0.148	9.424	142	0.085	0.106	5wlcNB.pdb.gz	The complete structure of the small-subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18509	5.19e-126	353	176	1.000	1.000	PACA_HUMAN Pituitary adenylate cyclase-activating polypeptide OS=Homo sapiens OX=9606 GN=ADCYAP1 PE=1 SV=3
2	P41535	3.19e-103	295	176	0.841	0.841	PACA_PIG Pituitary adenylate cyclase-activating polypeptide OS=Sus scrofa OX=9823 GN=ADCYAP1 PE=1 SV=3
3	P13589	5.56e-97	280	175	0.818	0.823	PACA_RAT Pituitary adenylate cyclase-activating polypeptide OS=Rattus norvegicus OX=10116 GN=Adcyap1 PE=1 SV=2
4	O70176	5.94e-97	280	175	0.824	0.829	PACA_MOUSE Pituitary adenylate cyclase-activating polypeptide OS=Mus musculus OX=10090 GN=Adcyap1 PE=2 SV=1
5	P16613	2.91e-95	275	176	0.824	0.824	PACA_SHEEP Pituitary adenylate cyclase-activating polypeptide OS=Ovis aries OX=9940 GN=ADCYAP1 PE=1 SV=1
6	Q29W19	3.73e-89	260	176	0.773	0.773	PACA_BOVIN Pituitary adenylate cyclase-activating polypeptide OS=Bos taurus OX=9913 GN=ADCYAP1 PE=2 SV=1
7	Q58FG9	1.19e-72	218	172	0.682	0.698	Q58FG9_CHICK Adenylate cyclase activating polypeptide 1 OS=Gallus gallus OX=9031 GN=PACAP PE=2 SV=1
8	P41534	1.56e-58	182	175	0.591	0.594	PACA_CHICK Glucagon family neuropeptides OS=Gallus gallus OX=9031 GN=ADCYAP1 PE=1 SV=2
9	Q98TU3	2.32e-56	177	175	0.557	0.560	Q98TU3_DANRE Adcyap1b protein OS=Danio rerio OX=7955 GN=PACAP2 PE=1 SV=1
10	Q9DE29	3.78e-52	166	172	0.528	0.541	Q9DE29_DANRE Adenylate cyclase activating polypeptide 1a isoform 1 precursor OS=Danio rerio OX=7955 GN=GRF-PACAP PE=3 SV=1
11	Q5XJ29	8.60e-42	140	199	0.466	0.412	Q5XJ29_DANRE Adcyap1a protein OS=Danio rerio OX=7955 GN=GRF-PACAP PE=2 SV=1
12	Q5XJ02	1.68e-40	135	140	0.455	0.571	Q5XJ02_DANRE Adcyap1b protein OS=Danio rerio OX=7955 GN=PACAP2 PE=1 SV=1
13	B8JIU2	7.88e-18	77.8	153	0.256	0.294	B8JIU2_DANRE VIP peptides OS=Danio rerio OX=7955 GN=vip1 PE=3 SV=1
14	P81401	3.63e-17	76.6	170	0.239	0.247	VIP_BOVIN VIP peptides OS=Bos taurus OX=9913 GN=VIP PE=1 SV=2
15	P32648	3.17e-16	73.9	170	0.216	0.224	VIP_MOUSE VIP peptides OS=Mus musculus OX=10090 GN=Vip PE=1 SV=1
16	P01283	4.69e-16	73.6	170	0.216	0.224	VIP_RAT VIP peptides OS=Rattus norvegicus OX=10116 GN=Vip PE=1 SV=2
17	P01282	5.97e-16	73.2	170	0.222	0.229	VIP_HUMAN VIP peptides OS=Homo sapiens OX=9606 GN=VIP PE=1 SV=1
18	P45644	3.04e-13	67.0	200	0.210	0.185	VIP_MELGA VIP peptides OS=Meleagris gallopavo OX=9103 GN=VIP PE=2 SV=1
19	P48143	4.27e-13	66.2	200	0.210	0.185	VIP_CHICK VIP peptides OS=Gallus gallus OX=9031 GN=VIP PE=1 SV=1
20	P01284	2.81e-11	58.5	75	0.188	0.440	VIP_PIG VIP peptides (Fragment) OS=Sus scrofa OX=9823 GN=VIP PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00123 Hormone_2	8.1e-18	75.3	Peptide hormone

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000462647

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000483721	0.999	Pituitary adenylate cyclase-activating polypeptide type I receptor
2	9606.ENSP00000327246	0.993	Vasoactive intestinal polypeptide receptor 1
3	9606.ENSP00000262178	0.986	Vasoactive intestinal polypeptide receptor 2
4	9606.ENSP00000360141	0.980	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
5	9606.ENSP00000334448	0.976	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
6	9606.ENSP00000176195	0.923	Secretin
7	9606.ENSP00000481878	0.881	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
8	9606.ENSP00000387662	0.865	Glucagon
9	9606.ENSP00000362716	0.848	Somatoliberin
10	9606.ENSP00000331746	0.841	Calcitonin
11	9606.ENSP00000229264	0.831	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-3
12	9606.ENSP00000276571	0.831	Corticoliberin
13	9606.ENSP00000334051	0.814	Guanine nucleotide-binding protein G(olf) subunit alpha
14	9606.ENSP00000362353	0.790	Glucagon-like peptide 1 receptor
15	9606.ENSP00000276414	0.787	Progonadoliberin-1
16	9606.ENSP00000019103	0.784	Secretin receptor
17	9606.ENSP00000384092	0.775	Pro-opiomelanocortin
18	9606.ENSP00000294117	0.773	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3
19	9606.ENSP00000277120	0.759	BDNF/NT-3 growth factors receptor
20	9606.ENSP00000305260	0.757	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051427	1.000	hormone receptor binding
GO:0005184	1.000	neuropeptide hormone activity
GO:0051428	0.984	peptide hormone receptor binding
GO:0016521	0.959	pituitary adenylate cyclase activating polypeptide activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0009987	0.995	cellular process
GO:0050794	0.995	regulation of cellular process
GO:0007165	0.989	signal transduction
GO:0048518	0.969	positive regulation of biological process
GO:0065009	0.966	regulation of molecular function
GO:0044093	0.964	positive regulation of molecular function
GO:0050790	0.959	regulation of catalytic activity
GO:0007189	0.959	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0019935	0.950	cyclic-nucleotide-mediated signaling
GO:0019222	0.949	regulation of metabolic process
GO:0043085	0.941	positive regulation of catalytic activity
GO:0019933	0.933	cAMP-mediated signaling
GO:0051339	0.919	regulation of lyase activity
GO:0031279	0.918	regulation of cyclase activity
GO:0019220	0.904	regulation of phosphate metabolic process
GO:0048522	0.899	positive regulation of cellular process
GO:0010604	0.899	positive regulation of macromolecule metabolic process
GO:0042325	0.893	regulation of phosphorylation
GO:0010562	0.876	positive regulation of phosphorus metabolic process
GO:0051247	0.866	positive regulation of protein metabolic process
GO:0001934	0.858	positive regulation of protein phosphorylation
GO:0032501	0.848	multicellular organismal process
GO:0051349	0.824	positive regulation of lyase activity
GO:0031281	0.824	positive regulation of cyclase activity
GO:0045860	0.823	positive regulation of protein kinase activity
GO:0045761	0.792	regulation of adenylate cyclase activity
GO:0010646	0.760	regulation of cell communication
GO:0023051	0.732	regulation of signaling
GO:0032879	0.694	regulation of localization
GO:0032880	0.680	regulation of protein localization
GO:0048583	0.650	regulation of response to stimulus
GO:0010468	0.650	regulation of gene expression
GO:0010647	0.615	positive regulation of cell communication
GO:0032502	0.614	developmental process
GO:0023056	0.607	positive regulation of signaling
GO:0009966	0.586	regulation of signal transduction
GO:0048856	0.576	anatomical structure development
GO:0048584	0.530	positive regulation of response to stimulus
GO:0045762	0.509	positive regulation of adenylate cyclase activity
GO:0007275	0.487	multicellular organism development
GO:1902533	0.481	positive regulation of intracellular signal transduction
GO:0048731	0.321	system development
GO:0051239	0.306	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0120025	0.479	plasma membrane bounded cell projection
GO:0016020	0.403	membrane
GO:0005615	0.400	extracellular space
GO:0005622	0.364	intracellular anatomical structure
GO:0043227	0.326	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]