StarFunc result for job id P18510

User Input

>input (177 residues)
MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYL
QGPNVNLEEKIDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQD
KRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18510	1.000	1.000	7.783E-34	177	1.000	1.000	P18510.pdb.gz	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
2	AFDB:P25085	0.872	0.867	4.947E-28	178	0.763	0.758	P25085.pdb.gz	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
3	AFDB:P25086	0.839	0.835	7.473E-27	178	0.740	0.736	P25086.pdb.gz	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
4	PDB:1irpA	0.657	0.746	2.305E-17	153	0.859	0.993	1irpA.pdb.gz
5	AFDB:A3DTN2	0.744	0.499	1.773E-15	267	0.362	0.240	A3DTN2.pdb.gz	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
6	AFDB:A3DTN4	0.746	0.498	1.143E-14	269	0.350	0.230	A3DTN4.pdb.gz	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
7	AFDB:Q9QYY1	0.744	0.838	1.414E-14	156	0.395	0.449	Q9QYY1.pdb.gz	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
8	PDB:1md6A	0.728	0.830	8.378E-14	154	0.395	0.455	1md6A.pdb.gz
9	AFDB:Q8WWZ1	0.728	0.840	1.014E-13	152	0.322	0.375	Q8WWZ1.pdb.gz	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
10	AFDB:P10749	0.750	0.506	3.270E-13	269	0.232	0.152	P10749.pdb.gz	IL1B_MOUSE Interleukin-1 beta OS=Mus musculus OX=10090 GN=Il1b PE=1 SV=1
11	PDB:5bowA	0.712	0.824	3.527E-13	151	0.322	0.377	5bowA.pdb.gz
12	AFDB:P01584	0.724	0.486	6.891E-13	269	0.232	0.152	P01584.pdb.gz	IL1B_HUMAN Interleukin-1 beta OS=Homo sapiens OX=9606 GN=IL1B PE=1 SV=2
13	AFDB:Q9NZH6	0.728	0.602	6.891E-13	218	0.254	0.206	Q9NZH6.pdb.gz	IL37_HUMAN Interleukin-37 OS=Homo sapiens OX=9606 GN=IL37 PE=1 SV=1
14	PDB:4izeA	0.673	0.776	1.371E-10	152	0.254	0.296	4izeA.pdb.gz
15	PDB:6hpiA	0.643	0.711	1.504E-9	158	0.260	0.291	6hpiA.pdb.gz
16	PDB:4qd2C	0.546	0.357	1.628E-3	286	0.124	0.077	4qd2C.pdb.gz	Molecular basis for disruption of E-cadherin adhesion by botulinum neurotoxin A complex.
17	PDB:3nbcA	0.581	0.679	1.811E-3	148	0.062	0.074	3nbcA.pdb.gz	Bivalent carbohydrate binding is required for biological activity of Clitocybe nebularis lectin (CNL), the N,N'-diacetyllactosediamine (GalNAc beta 1-4GlcNAc, LacdiNAc)-specific lectin from basidiomycete C. nebularis
18	PDB:1t9fA	0.529	0.526	2.629E-3	178	0.085	0.084	1t9fA.pdb.gz
19	PDB:7t3rA	0.475	0.055	6.163E-3	2130	0.113	0.009	7t3rA.pdb.gz	Structural basis for activation and gating of IP 3 receptors.
20	PDB:7a5px	0.438	0.584	6.500E-3	125	0.096	0.136	7a5px.pdb.gz	Structural Insights into the Roles of Metazoan-Specific Splicing Factors in the Human Step 1 Spliceosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18510	6.71e-134	373	177	1.000	1.000	IL1RA_HUMAN Interleukin-1 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL1RN PE=1 SV=1
2	P25085	1.29e-92	269	178	0.734	0.730	IL1RA_MOUSE Interleukin-1 receptor antagonist protein OS=Mus musculus OX=10090 GN=Il1rn PE=2 SV=1
3	P25086	6.39e-92	267	178	0.740	0.736	IL1RA_RAT Interleukin-1 receptor antagonist protein OS=Rattus norvegicus OX=10116 GN=Il1rn PE=2 SV=1
4	Q9UBH0	9.35e-37	126	155	0.407	0.465	I36RA_HUMAN Interleukin-36 receptor antagonist protein OS=Homo sapiens OX=9606 GN=IL36RN PE=1 SV=1
5	Q9QYY1	1.62e-34	120	156	0.401	0.455	I36RA_MOUSE Interleukin-36 receptor antagonist protein OS=Mus musculus OX=10090 GN=IL36RN PE=1 SV=2
6	A3DTN5	3.23e-27	105	267	0.350	0.232	A3DTN5_MELGA Interleukin-1 OS=Meleagris gallopavo OX=9103 GN=IL1RN PE=2 SV=1
7	A3DTN3	2.77e-26	102	267	0.345	0.228	A3DTN3_9AVES Interleukin-1 OS=Anser anser OX=8843 PE=2 SV=1
8	E9LHC8	2.89e-26	102	267	0.345	0.228	E9LHC8_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
9	A3DTN2	2.95e-26	102	267	0.345	0.228	A3DTN2_ANAPL Interleukin-1 OS=Anas platyrhynchos OX=8839 PE=2 SV=1
10	O73909	2.95e-26	102	267	0.345	0.228	O73909_CHICK Interleukin-1 OS=Gallus gallus OX=9031 GN=il-1beta PE=1 SV=1
11	Q8WWZ1	5.78e-26	99.0	152	0.328	0.382	IL1FA_HUMAN Interleukin-1 family member 10 OS=Homo sapiens OX=9606 GN=IL1F10 PE=1 SV=1
12	F4ZWC1	1.12e-25	101	267	0.345	0.228	F4ZWC1_CHICK Interleukin-1 OS=Gallus gallus OX=9031 PE=2 SV=1
13	A3DTN4	3.42e-24	97.4	269	0.339	0.223	A3DTN4_COLLI Interleukin-1 OS=Columba livia OX=8932 PE=2 SV=1
14	Q9NZH8	2.41e-13	66.6	169	0.260	0.272	IL36G_HUMAN Interleukin-36 gamma OS=Homo sapiens OX=9606 GN=IL36G PE=1 SV=1
15	Q9D6Z6	1.86e-12	64.3	183	0.198	0.191	IL36B_MOUSE Interleukin-36 beta OS=Mus musculus OX=10090 GN=Il36b PE=2 SV=1
16	M4WG34	1.59e-10	60.5	266	0.198	0.132	M4WG34_SHEEP Multifunctional fusion protein OS=Ovis aries OX=9940 GN=IL1b PE=2 SV=2
17	Q9JLA2	1.62e-10	58.9	160	0.226	0.250	IL36A_MOUSE Interleukin-36 alpha OS=Mus musculus OX=10090 GN=Il36a PE=1 SV=1
18	P21621	1.73e-10	60.1	266	0.198	0.132	IL1B_SHEEP Interleukin-1 beta OS=Ovis aries OX=9940 GN=IL1B PE=2 SV=2
19	Q8UUQ3	3.24e-10	59.3	260	0.282	0.192	Q8UUQ3_ONCMY Interleukin-1 OS=Oncorhynchus mykiss OX=8022 GN=IL1B1S PE=3 SV=1
20	P10749	3.45e-10	59.3	269	0.237	0.156	IL1B_MOUSE Interleukin-1 beta OS=Mus musculus OX=10090 GN=Il1b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00340 IL1	2e-37	138.9	Interleukin-1 / 18

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008958688.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003805143.1	0.997	Interleukin 1 receptor type 1
2	9597.XP_003805141.1	0.963	Interleukin 1 receptor type 2
3	9597.XP_003804552.1	0.879	Belongs to the IL-1 family
4	9597.XP_003805145.1	0.850	Interleukin-1 receptor-like 2 isoform X1
5	9597.XP_003822966.1	0.799	Interleukin 10
6	9597.XP_008976909.1	0.784	Interleukin-1 receptor accessory protein isoform X1
7	9597.XP_003804551.1	0.745	Potent proinflammatory cytokine. Initially discovered as the major endogenous pyrogen, induces prostaglandin synthesis, neutrophil influx and activation, T-cell activation and cytokine production, B- cell activation and antibody production, and fibroblast proliferation and collagen production
8	9597.NP_001266118.1	0.700	Adapter protein involved in the Toll-like receptor and IL-1 receptor signaling pathway in the innate immune response. Acts via IRAK1, IRAK2, IRF7 and TRAF6, leading to NF-kappa-B activation, cytokine secretion and the inflammatory response. Increases IL-8 transcription. Involved in IL-18-mediated signaling pathway. Activates IRF1 resulting in its rapid migration into the nucleus to mediate an efficient induction of IFN-beta, NOS2/INOS, and IL12A genes (By similarity). MyD88-mediated signaling in intestinal epithelial cells is crucial for maintenance of gut homeostasis and controls the [...]
9	9597.XP_008973822.1	0.689	TNF receptor superfamily member 1B
10	9597.XP_003824836.1	0.681	Interleukin-1 receptor-associated kinase 3 isoform X1
11	9597.XP_008962563.1	0.673	Interleukin-1 receptor-associated kinase 1
12	9597.XP_008958307.1	0.670	Interleukin 6
13	9597.XP_003805547.1	0.664	Toll-interacting protein
14	9597.XP_003826338.1	0.659	Interleukin 1 receptor associated kinase 2
15	9597.XP_003813715.1	0.646	Belongs to the G-protein coupled receptor 1 family.
16	9597.XP_008954361.1	0.641	Interferon kappa
17	9597.XP_003818518.1	0.635	Belongs to the G-protein coupled receptor 1 family.
18	9597.XP_003815860.1	0.632	Belongs to the peptidase S1 family.
19	9597.XP_003818511.1	0.630	Belongs to the G-protein coupled receptor 1 family.
20	9597.XP_003818509.1	0.622	Receptor for a number of inflammatory CC-chemokines including MIP-1-alpha, MIP-1-beta and RANTES and subsequently transduces a signal by increasing the intracellular calcium ion level. May play a role in the control of granulocytic lineage proliferation or differentiation (By similarity)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070851	1.000	growth factor receptor binding
GO:0005126	1.000	cytokine receptor binding
GO:0019955	0.999	cytokine binding
GO:0019838	0.997	growth factor binding
GO:0030547	0.996	signaling receptor inhibitor activity
GO:0048018	0.902	receptor ligand activity
GO:0005125	0.888	cytokine activity
GO:0005149	0.829	interleukin-1 receptor binding
GO:0005150	0.695	interleukin-1, type I receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.991	response to stimulus
GO:0050794	0.989	regulation of cellular process
GO:0009987	0.969	cellular process
GO:0048583	0.969	regulation of response to stimulus
GO:0009966	0.960	regulation of signal transduction
GO:0006954	0.957	inflammatory response
GO:0042221	0.926	response to chemical
GO:0048519	0.900	negative regulation of biological process
GO:0048523	0.892	negative regulation of cellular process
GO:0010033	0.890	response to organic substance
GO:0033993	0.870	response to lipid
GO:0048518	0.809	positive regulation of biological process
GO:0051716	0.794	cellular response to stimulus
GO:0007154	0.767	cell communication
GO:0023052	0.765	signaling
GO:0019222	0.730	regulation of metabolic process
GO:0048585	0.623	negative regulation of response to stimulus
GO:0002526	0.619	acute inflammatory response
GO:0060255	0.609	regulation of macromolecule metabolic process
GO:0002376	0.562	immune system process
GO:0006955	0.518	immune response
GO:0010468	0.506	regulation of gene expression
GO:0060759	0.499	regulation of response to cytokine stimulus
GO:0048522	0.493	positive regulation of cellular process
GO:0014070	0.476	response to organic cyclic compound
GO:0009605	0.453	response to external stimulus
GO:0051239	0.449	regulation of multicellular organismal process
GO:0009968	0.439	negative regulation of signal transduction
GO:0009893	0.413	positive regulation of metabolic process
GO:0070887	0.405	cellular response to chemical stimulus
GO:0001817	0.401	regulation of cytokine production
GO:0010604	0.385	positive regulation of macromolecule metabolic process
GO:0009719	0.384	response to endogenous stimulus
GO:0032501	0.380	multicellular organismal process
GO:0071704	0.373	organic substance metabolic process
GO:0071310	0.356	cellular response to organic substance
GO:0030155	0.352	regulation of cell adhesion
GO:0044419	0.338	biological process involved in interspecies interaction between organisms
GO:0009607	0.338	response to biotic stimulus
GO:0007165	0.332	signal transduction
GO:0051707	0.316	response to other organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.998	extracellular space
GO:0005886	0.989	plasma membrane
GO:0043226	0.946	organelle
GO:0043227	0.944	membrane-bounded organelle
GO:0031982	0.855	vesicle
GO:0005622	0.736	intracellular anatomical structure
GO:0043229	0.711	intracellular organelle
GO:0005737	0.581	cytoplasm
GO:0043231	0.472	intracellular membrane-bounded organelle
GO:0065010	0.468	extracellular membrane-bounded organelle
GO:1903561	0.441	extracellular vesicle
GO:0070062	0.433	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]