StarFunc result for job id P18583

User Input

>input (2426 residues)
MATNIEQIFRSFVVSKFREIQQELSSGRNEGQLNGETNTPIEGNQAGDAAASARSLPNEE
IVQKIEEVLSGVLDTELRYKPDLKEGSRKSRCVSVQTDPTDEIPTKKSKKHKKHKNKKKK
KKKEKEKKYKRQPEESESKTKSHDDGNIDLESDSFLKFDSEPSAVALELPTRAFGPSETN
ESPAVVLEPPVVSMEVSEPHILETLKPATKTAELSVVSTSVISEQSEQSVAVMPEPSMTK
ILDSFAAAPVPTTTLVLKSSEPVVTMSVEYQMKSVLKSVESTSPEPSKIMLVEPPVAKVL
EPSETLVVSSETPTEVYPEPSTSTTMDFPESSAIEALRLPEQPVDVPSEIADSSMTRPQE
LPELPKTTALELQESSVASAMELPGPPATSMPELQGPPVTPVLELPGPSATPVPELPGPL
STPVPELPGPPATAVPELPGPSVTPVPQLSQELPGLPAPSMGLEPPQEVPEPPVMAQELP
GLPLVTAAVELPEQPAVTVAMELTEQPVTTTELEQPVGMTTVEHPGHPEVTTATGLLGQP
EATMVLELPGQPVATTALELPGQPSVTGVPELPGLPSATRALELSGQPVATGALELPGPL
MAAGALEFSGQSGAAGALELLGQPLATGVLELPGQPGAPELPGQPVATVALEISVQSVVT
TSELSTMTVSQSLEVPSTTALESYNTVAQELPTTLVGETSVTVGVDPLMAPESHILASNT
METHILASNTMDSQMLASNTMDSQMLASNTMDSQMLASSTMDSQMLATSSMDSQMLATSS
MDSQMLATSTMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATSSMDSQMLATST
MDSQMLATSTMDSQMLATSSMDSQMLASGTMDSQMLASGTMDAQMLASGTMDAQMLASST
QDSAMLGSKSPDPYRLAQDPYRLAQDPYRLGHDPYRLGHDAYRLGQDPYRLGHDPYRLTP
DPYRMSPRPYRIAPRSYRIAPRPYRLAPRPLMLASRRSMMMSYAAERSMMSSYERSMMSY
ERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAERSMMSAYERSMMSAYERSMMSPMAD
RSMMSMGADRSMMSSYSAADRSMMSSYSAADRSMMSSYTADRSMMSMAADSYTDSYTDTY
TEAYMVPPLPPEEPPTMPPLPPEEPPMTPPLPPEEPPEGPALPTEQSALTAENTWPTEVP
SSPSEESVSQPEPPVSQSEISEPSAVPTDYSVSASDPSVLVSEAAVTVPEPPPEPESSIT
LTPVESAVVAEEHEVVPERPVTCMVSETPAMSAEPTVLASEPPVMSETAETFDSMRASGH
VASEVSTSLLVPAVTTPVLAESILEPPAMAAPESSAMAVLESSAVTVLESSTVTVLESST
VTVLEPSVVTVPEPPVVAEPDYVTIPVPVVSALEPSVPVLEPAVSVLQPSMIVSEPSVSV
QESTVTVSEPAVTVSEQTQVIPTEVAIESTPMILESSIMSSHVMKGINLSSGDQNLAPEI
GMQEIALHSGEEPHAEEHLKGDFYESEHGINIDLNINNHLIAKEMEHNTVCAAGTSPVGE
IGEEKILPTSETKQRTVLDTYPGVSEADAGETLSSTGPFALEPDATGTSKGIEFTTASTL
SLVNKYDVDLSLTTQDTEHDMVISTSPSGGSEADIEGPLPAKDIHLDLPSNNNLVSKDTE
EPLPVKESDQTLAALLSPKESSGGEKEVPPPPKETLPDSGFSANIEDINEADLVRPLLPK
DMERLTSLRAGIEGPLLASDVGRDRSAASPVVSSMPERASESSSEEKDDYEIFVKVKDTH
EKSKKNKNRDKGEKEKKRDSSLRSRSKRSKSSEHKSRKRTSESRSRARKRSSKSKSHRSQ
TRSRSRSRRRRRSSRSRSKSRGRRSVSKEKRKRSPKHRSKSRERKRKRSSSRDNRKTVRA
RSRTPSRRSRSHTPSRRRRSRSVGRRRSFSISPSRRSRTPSRRSRTPSRRSRTPSRRSRT
PSRRSRTPSRRSRTPSRRRRSRSVVRRRSFSISPVRLRRSRTPLRRRFSRSPIRRKRSRS
SERGRSPKRLTDLDKAQLLEIAKANAAAMCAKAGVPLPPNLKPAPPPTIEEKVAKKSGGA
TIEELTEKCKQIAQSKEDDDVIVNKPHVSDEEEEEPPFYHHPFKLSEPKPIFFNLNIAAA
KPTPPKSQVTLTKEFPVSSGSQHRKKEADSVYGEWVPVEKNGEENKDDDNVFSSNLPSEP
VDISTAMSERALAQKRLSENAFDLEAMSMLNRAQERIDAWAQLNSIPGQFTGSTGVQVLT
QEQLANTGAQAWIKKDQFLRAAPVTGGMGAVLMRKMGWREGEGLGKNKEGNKEPILVDFK
TDRKGLVAVGERAQKRSGNFSAAMKDLSGKHPVSALMEICNKRRWQPPEFLLVHDSGPDH
RKHFLFRVLRNGALTRPNCMFFLNRY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18583	1.000	1.000	0.000	2426	1.000	1.000	P18583.pdb.gz	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
2	AFDB:Q9QX47	0.167	0.166	0.000	2444	0.869	0.863	Q9QX47.pdb.gz	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
3	PDB:7zpkC	0.017	0.147	9.528E-3	233	0.007	0.069	7zpkC.pdb.gz	Structural and functional basis of mammalian microRNA biogenesis by Dicer.
4	AFDB:Q9NZM4	0.032	0.044	1.362E-2	1560	0.108	0.167	Q9NZM4.pdb.gz	BICRA_HUMAN BRD4-interacting chromatin-remodeling complex-associated protein OS=Homo sapiens OX=9606 GN=BICRA PE=1 SV=2
5	AFDB:Q8I5I9	0.030	0.030	2.663E-2	2432	0.088	0.088	Q8I5I9.pdb.gz	Q8I5I9_PLAF7 AP2 domain transcription factor AP2-G OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1222600 PE=4 SV=1
6	AFDB:Q5SS00	0.027	0.026	3.009E-2	2493	0.133	0.129	Q5SS00.pdb.gz	ZDBF2_MOUSE DBF4-type zinc finger-containing protein 2 homolog OS=Mus musculus OX=10090 GN=Zdbf2 PE=2 SV=1
7	AFDB:A0A0B4K6Y7	0.026	0.026	5.209E-2	2395	0.075	0.076	A0A0B4K6Y7.pdb.gz	A0A0B4K6Y7_DROME Polychaetoid, isoform O OS=Drosophila melanogaster OX=7227 GN=pyd PE=1 SV=1
8	PDB:7r97A	0.016	0.150	5.938E-2	226	0.005	0.049	7r97A.pdb.gz	Structural basis for Dicer-like function of an engineered RNase III variant and insights into the reaction trajectory of two-Mg 2+ -ion catalysis.
9	AFDB:Q7YSI9	0.028	0.036	6.255E-2	1654	0.066	0.096	Q7YSI9.pdb.gz	UNC53_CAEEL Adapter protein unc-53 OS=Caenorhabditis elegans OX=6239 GN=unc-53 PE=1 SV=1
10	AFDB:Q68DE3	0.023	0.022	7.511E-2	2245	0.156	0.168	Q68DE3.pdb.gz	USF3_HUMAN Basic helix-loop-helix domain-containing protein USF3 OS=Homo sapiens OX=9606 GN=USF3 PE=1 SV=4
11	AFDB:Q9W4M7	0.022	0.027	7.511E-2	1911	0.109	0.138	Q9W4M7.pdb.gz	Q9W4M7_DROME Twenty-four, isoform B OS=Drosophila melanogaster OX=7227 GN=tyf PE=1 SV=1
12	AFDB:F8VPZ9	0.030	0.041	7.984E-2	1578	0.101	0.156	F8VPZ9.pdb.gz	BICRA_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein OS=Mus musculus OX=10090 GN=Bicra PE=1 SV=1
13	PDB:1yykA	0.017	0.157	1.235E-1	221	0.006	0.068	1yykA.pdb.gz	Intermediate states of ribonuclease III in complex with double-stranded RNA
14	PDB:8dfvK	0.015	0.114	1.312E-1	253	0.005	0.047	8dfvK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
15	PDB:7v6cB	0.017	0.142	6.029E-1	260	0.004	0.035	7v6cB.pdb.gz	Structure of the Dicer-2-R2D2 heterodimer bound to a small RNA duplex.
16	PDB:8dgaK	0.017	0.184	9.240E-1	182	0.007	0.093	8dgaK.pdb.gz	Structural basis of microRNA biogenesis by Dicer-1 and its partner protein Loqs-PB.
17	PDB:3j6b5	0.020	0.121	9.821E-1	326	0.005	0.034	3j6b5.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
18	PDB:7l08c	0.017	0.127	1.505	289	0.005	0.038	7l08c.pdb.gz	Distinct mechanisms of the human mitoribosome recycling and antibiotic resistance.
19	PDB:4v8mAG	0.020	0.276	1.807	141	0.005	0.078	4v8mAG.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
20	PDB:7a1gY	0.020	0.273	2.170	150	0.005	0.087	7a1gY.pdb.gz	A structural inventory of native ribosomal ABCE1-43S pre-initiation complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H7C1M2	0.0	2821	1454	0.580	0.967	H7C1M2_HUMAN SON DNA and RNA binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SON PE=1 SV=1
2	P18583	0.0	4852	2426	1.000	1.000	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
3	Q6ZRV7	0.0	796	454	0.152	0.813	Q6ZRV7_HUMAN cDNA FLJ46057 fis, clone T1ESE2000609, highly similar to SON protein OS=Homo sapiens OX=9606 PE=1 SV=1
4	Q9QX47	0.0	2737	2444	0.666	0.661	SON_MOUSE Protein SON OS=Mus musculus OX=10090 GN=Son PE=1 SV=2
5	Q9VHB0	2.41e-43	175	874	0.036	0.101	SON_DROME Protein Son OS=Drosophila melanogaster OX=7227 GN=Son PE=1 SV=1
6	M9PC48	1.25e-11	73.6	18095	0.041	0.006	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
7	M9PCJ6	2.46e-11	72.4	18641	0.041	0.005	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
8	Q4WXC4	1.10e-10	68.9	430	0.026	0.144	Q4WXC4_ASPFU Cell surface protein, putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G08990 PE=4 SV=1
9	Q68DN1	2.92e-06	55.5	1984	0.029	0.036	CB016_HUMAN Uncharacterized protein C2orf16 OS=Homo sapiens OX=9606 GN=C2orf16 PE=2 SV=3
10	Q8IJI0	1.20e-05	53.1	538	0.026	0.117	Q8IJI0_PLAF7 Serine/arginine-rich splicing factor 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1022400 PE=4 SV=1
11	Q9SKI0	3.92e-05	50.4	291	0.024	0.199	Q9SKI0_ARATH At2g10940/F15K19.1 OS=Arabidopsis thaliana OX=3702 GN=At2g10940 PE=1 SV=1
12	Q4QRG7	0.001	46.2	434	0.021	0.120	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1
13	F1RAH8	0.003	45.1	450	0.022	0.120	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
14	P13608	0.004	45.4	2364	0.028	0.028	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
15	Q9XYZ6	0.007	44.3	653	0.027	0.101	Q9XYZ6_DROME Peptidyl-prolyl cis-trans isomerase OS=Drosophila melanogaster OX=7227 GN=UKL PE=2 SV=1
16	G4SLH0	0.019	43.1	18562	0.042	0.005	TTN1_CAEEL Titin homolog OS=Caenorhabditis elegans OX=6239 GN=ttn-1 PE=1 SV=2
17	Q61136	0.020	42.7	1007	0.031	0.073	PRP4B_MOUSE Serine/threonine-protein kinase PRP4 homolog OS=Mus musculus OX=10090 GN=Prpf4b PE=1 SV=3
18	Q8SZM4	0.032	42.0	1004	0.007	0.018	Q8SZM4_DROME RH03791p OS=Drosophila melanogaster OX=7227 GN=CG4887 PE=2 SV=1
19	Q9VPY4	0.033	42.0	1004	0.007	0.018	Q9VPY4_DROME FI21118p1 OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4887 PE=1 SV=1
20	Q01955	0.16	40.0	1670	0.015	0.022	CO4A3_HUMAN Collagen alpha-3(IV) chain OS=Homo sapiens OX=9606 GN=COL4A3 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14709 DND1_DSRM	0.00011	33.7	double strand RNA binding domain from DEAD END PROTEIN 1
2	PF01585 G-patch	3.4e-12	57.4	G-patch domain
3	PF12656 G-patch_2	0.16	23.4	G-patch domain
4	PF17069 RSRP	2.3e-06	39.0	Arginine/Serine-Rich protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000348984

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308622	0.908	Nucleoporin GLE1
2	9606.ENSP00000337194	0.842	Serine/threonine-protein kinase PRP4 homolog
3	9606.ENSP00000386759	0.834	Histone-lysine N-methyltransferase SETD2
4	9606.ENSP00000317872	0.807	E3 ubiquitin-protein ligase RBBP6
5	9606.ENSP00000307143	0.788	Protein downstream neighbor of Son
6	9606.ENSP00000352400	0.745	Nuclear pore complex protein Nup214
7	9606.ENSP00000436679	0.728	Nuclear RNA export factor 1
8	9606.ENSP00000325905	0.725	Serine/arginine-rich splicing factor 7
9	9606.ENSP00000370966	0.715	Quinone oxidoreductase-like protein 1
10	9606.ENSP00000283195	0.706	E3 SUMO-protein ligase RanBP2
11	9606.ENSP00000382250	0.705	Mitochondrial ribosomal protein S6
12	9606.ENSP00000376345	0.698	Growth factor receptor-bound protein 2
13	9606.ENSP00000466363	0.656	Phosphatidylinositol 4-phosphate 5-kinase type-1 gamma
14	9606.ENSP00000365757	0.649	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha
15	9606.ENSP00000233156	0.647	Tissue factor pathway inhibitor
16	9606.ENSP00000429084	0.646	E3 ubiquitin-protein ligase UBR5
17	9606.ENSP00000439768	0.644	Belongs to the UPF0220 family
18	9606.ENSP00000288071	0.642	ATP-dependent RNA helicase DDX19B
19	9606.ENSP00000484532	0.628	Protein MIS12 homolog
20	9606.ENSP00000307208	0.618	Nucleosome-remodeling factor subunit BPTF

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.995	cellular metabolic process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.993	primary metabolic process
GO:0050794	0.989	regulation of cellular process
GO:0006807	0.987	nitrogen compound metabolic process
GO:0016070	0.982	RNA metabolic process
GO:0016043	0.969	cellular component organization
GO:0010467	0.969	gene expression
GO:0031323	0.965	regulation of cellular metabolic process
GO:0016071	0.964	mRNA metabolic process
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:1903311	0.946	regulation of mRNA metabolic process
GO:0010468	0.941	regulation of gene expression
GO:0048519	0.937	negative regulation of biological process
GO:0048523	0.923	negative regulation of cellular process
GO:0006396	0.917	RNA processing
GO:0000278	0.861	mitotic cell cycle
GO:0050684	0.860	regulation of mRNA processing
GO:0043484	0.856	regulation of RNA splicing
GO:0006397	0.823	mRNA processing
GO:0007017	0.807	microtubule-based process
GO:1903047	0.742	mitotic cell cycle process
GO:0010941	0.709	regulation of cell death
GO:0051301	0.690	cell division
GO:0048024	0.679	regulation of mRNA splicing, via spliceosome
GO:0006996	0.575	organelle organization
GO:0000910	0.515	cytokinesis
GO:0061640	0.514	cytoskeleton-dependent cytokinesis
GO:0000281	0.453	mitotic cytokinesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	0.999	nuclear speck
GO:0005737	0.788	cytoplasm
GO:0032991	0.595	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]