StarFunc result for job id P18615

User Input

>input (380 residues)
MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTAT
ATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDL
QESSRRPQRKSLYESFVSSSDRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSA
SPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRERDRDRERDRDR
DREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFV
TYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRD
KRTQIVYSDDVYKENLVDGF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1U9X830	0.511	0.511	1.494E-60	380	1.000	1.000	A0A1U9X830.pdb.gz	A0A1U9X830_HUMAN Negative elongation factor E OS=Homo sapiens OX=9606 PE=3 SV=1
2	AFDB:A0A2R8QPV7	0.282	0.273	1.306E-35	394	0.642	0.619	A0A2R8QPV7.pdb.gz
3	PDB:3lqvB	0.194	0.585	1.098E-6	115	0.068	0.226	3lqvB.pdb.gz	Branch Recognition by SF3b14
4	PDB:3pgwP	0.187	0.587	1.875E-6	113	0.055	0.186	3pgwP.pdb.gz
5	PDB:7oqcF	0.190	0.264	2.801E-6	267	0.068	0.097	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
6	PDB:5yzg1	0.175	0.269	4.472E-6	243	0.068	0.107	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
7	PDB:5lsbA	0.169	0.345	5.112E-6	176	0.058	0.125	5lsbA.pdb.gz
8	PDB:6ff7X	0.183	0.392	5.465E-6	171	0.058	0.129	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
9	PDB:6exnY	0.186	0.734	7.635E-6	87	0.066	0.287	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
10	PDB:5vsuA	0.183	0.180	1.067E-5	387	0.063	0.062	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
11	PDB:6gd1A	0.169	0.326	1.140E-5	190	0.061	0.121	6gd1A.pdb.gz
12	PDB:7dvqY	0.177	0.448	2.081E-5	140	0.053	0.143	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
13	AFDB:Q9P789	0.203	0.076	6.405E-5	1065	0.111	0.039	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
14	AFDB:P91156	0.181	0.121	8.368E-5	580	0.161	0.105	P91156.pdb.gz	P91156_CAEEL SAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=acin-1 PE=1 SV=2
15	AFDB:Q3THB3	0.177	0.101	2.788E-4	690	0.105	0.058	Q3THB3.pdb.gz	Q3THB3_MOUSE RRM domain-containing protein OS=Mus musculus OX=10090 GN=Hnrnpm PE=1 SV=1
16	AFDB:Q86YN6	0.159	0.068	3.308E-3	1023	0.118	0.044	Q86YN6.pdb.gz	PRGC2_HUMAN Peroxisome proliferator-activated receptor gamma coactivator 1-beta OS=Homo sapiens OX=9606 GN=PPARGC1B PE=1 SV=2
17	AFDB:P21187	0.181	0.111	7.379E-3	634	0.092	0.055	P21187.pdb.gz	PABP_DROME Polyadenylate-binding protein OS=Drosophila melanogaster OX=7227 GN=pAbp PE=1 SV=3
18	AFDB:Q8T6B9	0.167	0.105	7.379E-3	637	0.097	0.058	Q8T6B9.pdb.gz	PUF68_DROME Poly(U)-binding-splicing factor half pint OS=Drosophila melanogaster OX=7227 GN=hfp PE=1 SV=2
19	AFDB:Q19579	0.177	0.100	1.260E-2	692	0.079	0.043	Q19579.pdb.gz	Q19579_CAEEL Polyadenylate-binding protein OS=Caenorhabditis elegans OX=6239 GN=pab-2 PE=1 SV=1
20	AFDB:Q38C20	0.183	0.123	1.540E-2	588	0.103	0.066	Q38C20.pdb.gz	Q38C20_TRYB2 NTF2 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5500 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MSN9	0.0	657	333	0.876	1.000	A0A0A0MSN9_HUMAN Negative elongation factor E (Fragment) OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=6
2	A0A0A0MT02	0.0	577	293	0.771	1.000	A0A0A0MT02_HUMAN Negative elongation factor E (Fragment) OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=6
3	A0A1U9X830	0.0	764	380	1.000	1.000	A0A1U9X830_HUMAN Negative elongation factor E OS=Homo sapiens OX=9606 PE=3 SV=1
4	A0A8J8XR86	0.0	526	387	0.884	0.868	A0A8J8XR86_RAT Negative elongation factor E OS=Rattus norvegicus OX=10116 GN=Nelfe PE=1 SV=1
5	P18615	0.0	764	380	1.000	1.000	NELFE_HUMAN Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=3
6	E9PD43	3.75e-179	499	260	0.684	1.000	E9PD43_HUMAN Negative elongation factor complex member E (Fragment) OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=1
7	A2ABK4	5.42e-107	313	159	0.418	1.000	A2ABK4_HUMAN Negative elongation factor E (Fragment) OS=Homo sapiens OX=9606 GN=NELFE PE=1 SV=1
8	Q6MG75	5.54e-90	277	369	0.429	0.442	Q6MG75_RAT Negative elongation factor E OS=Rattus norvegicus OX=10116 GN=Nelfe PE=1 SV=1
9	P19426	7.27e-88	272	375	0.424	0.429	NELFE_MOUSE Negative elongation factor E OS=Mus musculus OX=10090 GN=Nelfe PE=1 SV=2
10	Q1LWQ2	1.85e-61	203	346	0.247	0.272	Q1LWQ2_DANRE Negative elongation factor E OS=Danio rerio OX=7955 GN=rdbp PE=1 SV=1
11	Q6DHD7	1.87e-61	203	346	0.247	0.272	Q6DHD7_DANRE Negative elongation factor E OS=Danio rerio OX=7955 GN=rdbp PE=1 SV=1
12	P92204	4.39e-24	102	280	0.124	0.168	NELFE_DROME Negative elongation factor E OS=Drosophila melanogaster OX=7227 GN=Nelf-E PE=1 SV=1
13	F1QBY1	4.63e-09	60.8	2876	0.074	0.010	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
14	Q6PGZ3	6.36e-08	57.0	629	0.066	0.040	MIPT3_DANRE TRAF3-interacting protein 1 OS=Danio rerio OX=7955 GN=traf3ip1 PE=2 SV=1
15	Q9LFE0	4.34e-07	54.3	820	0.074	0.034	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
16	F4JQG2	7.17e-07	53.5	551	0.076	0.053	F4JQG2_ARATH Splicing factor U2af large subunit OS=Arabidopsis thaliana OX=3702 GN=ATU2AF65A PE=1 SV=1
17	P70318	8.56e-07	52.8	392	0.068	0.066	TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus OX=10090 GN=Tial1 PE=1 SV=1
18	Q5BJN3	8.56e-07	52.8	392	0.068	0.066	Q5BJN3_RAT Tia1 cytotoxic granule-associated RNA binding protein-like 1 OS=Rattus norvegicus OX=10116 GN=Tial1 PE=4 SV=1
19	A0A8I6GIU6	8.74e-07	52.8	375	0.068	0.069	A0A8I6GIU6_RAT Tia1 cytotoxic granule-associated RNA binding protein-like 1 OS=Rattus norvegicus OX=10116 GN=Tial1 PE=4 SV=1
20	Q01085	8.90e-07	52.8	375	0.068	0.069	TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14605 Nup35_RRM_2	27	16.2	Nup53/35/40-type RNA recognition motif
2	PF00076 RRM_1	9.9e-08	43.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16842 RRM_occluded	1.1e+02	14.1	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364578

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000339495	0.999	Negative elongation factor B
2	9606.ENSP00000372335	0.999	Negative elongation factor A
3	9606.ENSP00000473290	0.999	Negative elongation factor C/D
4	9606.ENSP00000326806	0.995	Nuclear cap-binding protein subunit 2
5	9606.ENSP00000364289	0.994	Nuclear cap-binding protein subunit 1
6	9606.ENSP00000225504	0.993	Transcription elongation factor SPT4
7	9606.ENSP00000470252	0.989	Transcription elongation factor SPT5
8	9606.ENSP00000480158	0.981	DNA-directed RNA polymerase II subunit RPB1
9	9606.ENSP00000219252	0.945	DNA-directed RNA polymerase II subunit RPB3
10	9606.ENSP00000301788	0.932	DNA-directed RNA polymerase II subunit RPB7
11	9606.ENSP00000403852	0.928	DNA-directed RNA polymerases I, II, and III subunit RPABC2
12	9606.ENSP00000292614	0.927	DNA-directed RNA polymerase II subunit RPB11-a
13	9606.ENSP00000478303	0.925	DNA-directed RNA polymerases I, II, and III subunit RPABC1
14	9606.ENSP00000221859	0.923	DNA-directed RNA polymerase II subunit RPB9
15	9606.ENSP00000370625	0.922	DNA-directed RNA polymerase II subunit RPB2
16	9606.ENSP00000324124	0.920	DNA-directed RNA polymerases I, II, and III subunit RPABC5
17	9606.ENSP00000272645	0.916	DNA-directed RNA polymerase II subunit RPB4
18	9606.ENSP00000342889	0.916	DNA-directed RNA polymerases I, II, and III subunit RPABC4
19	9606.ENSP00000362361	0.889	Cyclin-dependent kinase 9
20	9606.ENSP00000377969	0.878	General transcription factor IIF subunit 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0045892	0.998	negative regulation of DNA-templated transcription
GO:0032784	0.952	regulation of DNA-templated transcription elongation
GO:0034243	0.863	regulation of transcription elongation by RNA polymerase II
GO:0009987	0.513	cellular process
GO:0048518	0.508	positive regulation of biological process
GO:0048522	0.486	positive regulation of cellular process
GO:0010604	0.444	positive regulation of macromolecule metabolic process
GO:0031325	0.439	positive regulation of cellular metabolic process
GO:0051173	0.436	positive regulation of nitrogen compound metabolic process
GO:0051254	0.315	positive regulation of RNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016020	0.989	membrane
GO:0016604	0.977	nuclear body
GO:0032991	0.958	protein-containing complex
GO:0140513	0.932	nuclear protein-containing complex
GO:0071944	0.913	cell periphery
GO:0005886	0.896	plasma membrane
GO:0005737	0.507	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]