StarFunc result for job id P18627

User Input

>input (525 residues)
MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAG
VTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRV
QLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLR
ASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWG
CILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP
PGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGS
PGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERL
LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRP
RRFSALEQGIHPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18627	1.000	1.000	1.392E-95	525	1.000	1.000	P18627.pdb.gz	LAG3_HUMAN Lymphocyte activation gene 3 protein OS=Homo sapiens OX=9606 GN=LAG3 PE=1 SV=5
2	AFDB:Q61790	0.494	0.498	1.998E-66	521	0.672	0.678	Q61790.pdb.gz	LAG3_MOUSE Lymphocyte activation gene 3 protein OS=Mus musculus OX=10090 GN=Lag3 PE=1 SV=1
3	AFDB:U5IJK6	0.410	0.443	8.872E-24	476	0.177	0.195	U5IJK6.pdb.gz
4	AFDB:Q1W648	0.409	0.445	1.260E-23	471	0.162	0.180	Q1W648.pdb.gz	Q1W648_ICTPU CD4-1 molecule isoform X1 OS=Ictalurus punctatus OX=7998 GN=cd4-1 PE=4 SV=1
5	AFDB:P06332	0.465	0.520	1.705E-22	457	0.164	0.188	P06332.pdb.gz	CD4_MOUSE T-cell surface glycoprotein CD4 OS=Mus musculus OX=10090 GN=Cd4 PE=1 SV=1
6	AFDB:P01730	0.472	0.526	3.623E-21	458	0.175	0.201	P01730.pdb.gz	CD4_HUMAN T-cell surface glycoprotein CD4 OS=Homo sapiens OX=9606 GN=CD4 PE=1 SV=1
7	AFDB:A0A0R4IT56	0.265	0.260	8.947E-20	537	0.173	0.169	A0A0R4IT56.pdb.gz
8	AFDB:Q9HBG7	0.227	0.193	3.137E-18	655	0.175	0.140	Q9HBG7.pdb.gz	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
9	AFDB:Q6PA07	0.236	0.141	2.573E-17	1043	0.137	0.069	Q6PA07.pdb.gz	Q6PA07_XENLA MGC68806 protein OS=Xenopus laevis OX=8355 GN=ptk7.L PE=1 SV=1
10	AFDB:Q01965	0.236	0.201	2.705E-17	654	0.170	0.136	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
11	PDB:5oj2B	0.169	0.135	5.132E-12	692	0.141	0.107	5oj2B.pdb.gz
12	PDB:1e07A	0.253	0.219	1.265E-11	642	0.116	0.095	1e07A.pdb.gz
13	PDB:6dldD	0.202	0.310	1.265E-11	269	0.095	0.186	6dldD.pdb.gz
14	PDB:6dlfA	0.180	0.334	6.621E-10	236	0.086	0.191	6dlfA.pdb.gz
15	PDB:7q1yA	0.159	0.074	9.422E-9	1374	0.093	0.036	7q1yA.pdb.gz
16	PDB:5a42A	0.169	0.071	2.566E-8	1597	0.090	0.029	5a42A.pdb.gz
17	PDB:4ziqA	0.143	0.067	5.721E-8	1450	0.093	0.034	4ziqA.pdb.gz
18	PDB:1igaA	0.182	0.199	8.541E-8	475	0.126	0.139	1igaA.pdb.gz
19	PDB:1hzhH	0.179	0.203	9.442E-8	457	0.116	0.133	1hzhH.pdb.gz	Crystal structure of a neutralizing human IGG against HIV-1: a template for vaccine design.
20	PDB:7sqcO0	0.159	0.091	1.638E-7	1140	0.112	0.052	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18627	0.0	1040	525	1.000	1.000	LAG3_HUMAN Lymphocyte activation gene 3 protein OS=Homo sapiens OX=9606 GN=LAG3 PE=1 SV=5
2	Q61790	0.0	627	521	0.642	0.647	LAG3_MOUSE Lymphocyte activation gene 3 protein OS=Mus musculus OX=10090 GN=Lag3 PE=1 SV=1
3	D3ZZ80	7.32e-08	57.8	1805	0.090	0.026	OBSL1_RAT Obscurin-like protein 1 OS=Rattus norvegicus OX=10116 GN=Obsl1 PE=2 SV=3
4	P98160	1.29e-06	53.9	4391	0.141	0.017	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
5	P27930	4.60e-06	51.2	398	0.166	0.219	IL1R2_HUMAN Interleukin-1 receptor type 2 OS=Homo sapiens OX=9606 GN=IL1R2 PE=1 SV=1
6	P43146	9.90e-06	50.8	1447	0.109	0.039	DCC_HUMAN Netrin receptor DCC OS=Homo sapiens OX=9606 GN=DCC PE=1 SV=2
7	Q63155	1.41e-05	50.4	1445	0.107	0.039	DCC_RAT Netrin receptor DCC OS=Rattus norvegicus OX=10116 GN=Dcc PE=1 SV=2
8	P13688	2.30e-05	49.3	526	0.124	0.124	CEAM1_HUMAN Carcinoembryonic antigen-related cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=CEACAM1 PE=1 SV=2
9	P70211	2.52e-05	49.7	1447	0.107	0.039	DCC_MOUSE Netrin receptor DCC OS=Mus musculus OX=10090 GN=Dcc PE=1 SV=2
10	O75147	3.40e-05	49.3	1896	0.086	0.024	OBSL1_HUMAN Obscurin-like protein 1 OS=Homo sapiens OX=9606 GN=OBSL1 PE=1 SV=4
11	Q91562	4.42e-05	48.9	1427	0.120	0.044	Q91562_XENLA Deleted in colorectal carcinoma OS=Xenopus laevis OX=8355 GN=dcc.L PE=1 SV=1
12	P20241	7.88e-05	48.1	1302	0.126	0.051	NRG_DROME Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2
13	A0A8I6ASH2	1.22e-04	47.8	4387	0.133	0.016	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
14	A0A8I6A2S5	1.25e-04	47.4	4402	0.133	0.016	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
15	F1LTJ5	1.94e-04	47.0	2438	0.133	0.029	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
16	Q1W648	3.64e-04	45.4	471	0.114	0.127	Q1W648_ICTPU CD4-1 molecule isoform X1 OS=Ictalurus punctatus OX=7998 GN=cd4-1 PE=4 SV=1
17	Q1W651	3.93e-04	45.4	471	0.114	0.127	Q1W651_ICTPU CD4-1 molecule precursor OS=Ictalurus punctatus OX=7998 GN=cd4-1 PE=2 SV=1
18	E7F3V2	4.02e-04	45.8	4212	0.150	0.019	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
19	A2AJ76	5.41e-04	45.4	5100	0.109	0.011	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
20	Q925P2	7.98e-04	44.3	520	0.105	0.106	CEAM2_MOUSE Carcinoembryonic antigen-related cell adhesion molecule 2 OS=Mus musculus OX=10090 GN=Ceacam2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	5.3e-05	34.5	Immunoglobulin I-set domain
2	PF00047 ig	2.4e-08	45.4	Immunoglobulin domain
3	PF13895 Ig_2	3.5e-05	35.4	Immunoglobulin domain
4	PF13927 Ig_3	1.4e-09	49.7	Immunoglobulin domain
5	PF18452 Ig_6	5.2	18.3	Immunoglobulin domain
6	PF16706 Izumo-Ig	2.5	19.4	Izumo-like Immunoglobulin domain
7	PF12191 stn_TNFRSF12A	1.7e+02	13.9	Tumour necrosis factor receptor stn_TNFRSF12A_TNFR domain
8	PF05887 Trypan_PARP	35	15.8	Procyclic acidic repetitive protein (PARP)
9	PF07686 V-set	1e-10	53.1	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000203629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254301	0.987	Galectin-3
2	9606.ENSP00000327599	0.973	C-type lectin domain family 4 member G
3	9606.ENSP00000338345	0.926	Alpha-synuclein
4	9606.ENSP00000381133	0.916	Fibrinogen-like protein 1
5	9606.ENSP00000312002	0.913	Hepatitis A virus cellular receptor 2
6	9606.ENSP00000370989	0.892	Programmed cell death 1 ligand 1
7	9606.ENSP00000011653	0.888	T-cell surface glycoprotein CD4
8	9606.ENSP00000303939	0.887	Cytotoxic T-lymphocyte protein 4
9	9606.ENSP00000419085	0.868	T-cell immunoreceptor with Ig and ITIM domains
10	9606.ENSP00000335062	0.852	Programmed cell death protein 1
11	9606.ENSP00000235933	0.831	CD160 antigen
12	9606.ENSP00000386559	0.830	T-cell surface glycoprotein CD8 alpha chain
13	9606.ENSP00000264246	0.828	T-lymphocyte activation antigen CD80
14	9606.ENSP00000333919	0.802	B- and T-lymphocyte attenuator
15	9606.ENSP00000380855	0.777	Programmed cell death 1 ligand 2
16	9606.ENSP00000365380	0.771	Forkhead box protein P3
17	9606.ENSP00000328207	0.769	Tumor necrosis factor receptor superfamily member 18
18	9606.ENSP00000368538	0.765	Tumor necrosis factor receptor superfamily member 4
19	9606.ENSP00000478699	0.761	Tumor necrosis factor receptor superfamily member 9
20	9606.ENSP00000216341	0.726	Granzyme B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042287	1.000	MHC protein binding
GO:0003823	0.993	antigen binding
GO:0042289	0.763	MHC class II protein binding
GO:0038023	0.508	signaling receptor activity
GO:0042802	0.367	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.996	response to stimulus
GO:0050789	0.996	regulation of biological process
GO:0002376	0.994	immune system process
GO:0009987	0.992	cellular process
GO:0048523	0.988	negative regulation of cellular process
GO:0048518	0.987	positive regulation of biological process
GO:0010468	0.987	regulation of gene expression
GO:0023052	0.981	signaling
GO:0050793	0.978	regulation of developmental process
GO:0051249	0.977	regulation of lymphocyte activation
GO:0048583	0.976	regulation of response to stimulus
GO:0031347	0.969	regulation of defense response
GO:1903706	0.968	regulation of hemopoiesis
GO:0048522	0.960	positive regulation of cellular process
GO:0001817	0.951	regulation of cytokine production
GO:0045088	0.950	regulation of innate immune response
GO:0006955	0.949	immune response
GO:0051716	0.941	cellular response to stimulus
GO:0032501	0.938	multicellular organismal process
GO:0050778	0.936	positive regulation of immune response
GO:1902105	0.935	regulation of leukocyte differentiation
GO:0051707	0.929	response to other organism
GO:0002697	0.926	regulation of immune effector process
GO:0007165	0.926	signal transduction
GO:0050863	0.925	regulation of T cell activation
GO:0006950	0.901	response to stress
GO:0007166	0.901	cell surface receptor signaling pathway
GO:0022407	0.900	regulation of cell-cell adhesion
GO:1903037	0.886	regulation of leukocyte cell-cell adhesion
GO:0002706	0.880	regulation of lymphocyte mediated immunity
GO:0031341	0.835	regulation of cell killing
GO:0051241	0.828	negative regulation of multicellular organismal process
GO:0006952	0.814	defense response
GO:0032103	0.814	positive regulation of response to external stimulus
GO:0002715	0.736	regulation of natural killer cell mediated immunity
GO:0045321	0.711	leukocyte activation
GO:0002683	0.685	negative regulation of immune system process
GO:0001910	0.672	regulation of leukocyte mediated cytotoxicity
GO:0031349	0.671	positive regulation of defense response
GO:0002699	0.612	positive regulation of immune effector process
GO:0009893	0.564	positive regulation of metabolic process
GO:0002705	0.542	positive regulation of leukocyte mediated immunity
GO:0009892	0.539	negative regulation of metabolic process
GO:0010605	0.526	negative regulation of macromolecule metabolic process
GO:0002708	0.523	positive regulation of lymphocyte mediated immunity
GO:0045619	0.519	regulation of lymphocyte differentiation
GO:0046649	0.500	lymphocyte activation
GO:0002833	0.499	positive regulation of response to biotic stimulus
GO:0042269	0.480	regulation of natural killer cell mediated cytotoxicity
GO:0051093	0.477	negative regulation of developmental process
GO:0010604	0.475	positive regulation of macromolecule metabolic process
GO:0001818	0.440	negative regulation of cytokine production
GO:0031343	0.437	positive regulation of cell killing
GO:0002695	0.429	negative regulation of leukocyte activation
GO:0045089	0.422	positive regulation of innate immune response
GO:0032502	0.416	developmental process
GO:0051240	0.415	positive regulation of multicellular organismal process
GO:0007162	0.411	negative regulation of cell adhesion
GO:0045580	0.405	regulation of T cell differentiation
GO:0051250	0.404	negative regulation of lymphocyte activation
GO:0048856	0.399	anatomical structure development
GO:1903038	0.397	negative regulation of leukocyte cell-cell adhesion
GO:0042110	0.396	T cell activation
GO:0050868	0.393	negative regulation of T cell activation
GO:0002717	0.388	positive regulation of natural killer cell mediated immunity
GO:0002252	0.382	immune effector process
GO:0045087	0.382	innate immune response
GO:0010721	0.368	negative regulation of cell development
GO:0045954	0.331	positive regulation of natural killer cell mediated cytotoxicity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0043227	0.925	membrane-bounded organelle
GO:0005622	0.891	intracellular anatomical structure
GO:0043231	0.854	intracellular membrane-bounded organelle
GO:0005737	0.754	cytoplasm
GO:0012505	0.725	endomembrane system
GO:0032991	0.622	protein-containing complex
GO:0009986	0.484	cell surface
GO:0005576	0.388	extracellular region
GO:0031982	0.301	vesicle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]