StarFunc result for job id P18825

User Input

>input (462 residues)
MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGF
LIVFTVVGNVLVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFG
QVWCGVYLALDVLFCTSSIVHLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISA
VISFPPLVSLYRQPDGAAYPQCGLNDETWYILSSCIGSFFAPCLIMGLVYARIYRVAKLR
TRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPPADVEPDESSAAAERRRRRGA
LRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASSRSVEFFLSRR
RRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18825	1.000	1.000	6.594E-54	462	1.000	1.000	P18825.pdb.gz	ADA2C_HUMAN Alpha-2C adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2C PE=1 SV=2
2	AFDB:A0A060YLN9	0.698	0.843	3.245E-32	380	0.532	0.647	A0A060YLN9.pdb.gz	A0A060YLN9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008424001 PE=3 SV=1
3	AFDB:A0A060YJS0	0.674	0.883	3.173E-31	351	0.528	0.695	A0A060YJS0.pdb.gz	A0A060YJS0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00031345001 PE=3 SV=1
4	AFDB:P08913	0.626	0.622	2.059E-29	465	0.535	0.531	P08913.pdb.gz	ADA2A_HUMAN Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4
5	AFDB:Q8JG69	0.672	0.745	3.927E-29	415	0.504	0.561	Q8JG69.pdb.gz	AA2DB_DANRE Alpha-2Db adrenergic receptor OS=Danio rerio OX=7955 GN=adra2db PE=3 SV=1
6	AFDB:Q90WY5	0.631	0.574	6.037E-29	510	0.500	0.453	Q90WY5.pdb.gz	ADA2B_DANRE Alpha-2B adrenergic receptor OS=Danio rerio OX=7955 GN=adra2b PE=3 SV=1
7	AFDB:A0A060W139	0.620	0.731	7.816E-29	390	0.472	0.559	A0A060W139.pdb.gz	A0A060W139_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077426001 PE=3 SV=1
8	AFDB:A0A060YPY0	0.665	0.793	8.159E-29	384	0.476	0.573	A0A060YPY0.pdb.gz	A0A060YPY0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028829001 PE=3 SV=1
9	AFDB:P19328	0.635	0.647	8.892E-29	453	0.487	0.497	P19328.pdb.gz	ADA2B_RAT Alpha-2B adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2b PE=1 SV=2
10	AFDB:P18089	0.611	0.627	1.255E-28	450	0.494	0.507	P18089.pdb.gz	ADA2B_HUMAN Alpha-2B adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2B PE=1 SV=4
11	PDB:7ejaR	0.527	0.883	5.301E-19	269	0.437	0.751	7ejaR.pdb.gz	Structural insights into ligand recognition, activation, and signaling of the alpha 2A adrenergic receptor.
12	PDB:7e32R	0.528	0.839	6.697E-16	285	0.251	0.407	7e32R.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
13	PDB:7e2xR	0.518	0.843	2.653E-15	278	0.255	0.424	7e2xR.pdb.gz	Structural insights into the lipid and ligand regulation of serotonin receptors.
14	PDB:6iblA	0.529	0.611	1.361E-14	397	0.227	0.264	6iblA.pdb.gz	Molecular basis of beta-arrestin coupling to formoterol-bound beta1-adrenoceptor.
15	PDB:3pblA	0.546	0.583	3.081E-14	432	0.288	0.308	3pblA.pdb.gz	Structure of the human dopamine d3 receptor in complex with a d2/d3 selective antagonist.
16	PDB:7jvqR	0.491	0.772	5.875E-14	286	0.240	0.388	7jvqR.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
17	PDB:7xt8R	0.507	0.779	1.450E-13	294	0.234	0.367	7xt8R.pdb.gz	GPCRs steer G i and G s selectivity via TM5-TM6 switches as revealed by structures of serotonin receptors.
18	PDB:5d5aA	0.538	0.562	2.648E-13	442	0.240	0.251	5d5aA.pdb.gz	In meso in situ serial X-ray crystallography of soluble and membrane proteins at cryogenic temperatures.
19	PDB:4ldeA	0.510	0.519	3.284E-13	454	0.199	0.203	4ldeA.pdb.gz	Adrenaline-activated structure of beta 2-adrenoceptor stabilized by an engineered nanobody.
20	PDB:7cmuR	0.531	0.881	3.900E-13	272	0.258	0.438	7cmuR.pdb.gz	Structures of the human dopamine D3 receptor-G i complexes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18825	0.0	919	462	1.000	1.000	ADA2C_HUMAN Alpha-2C adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2C PE=1 SV=2
2	P22086	0.0	684	458	0.903	0.910	ADA2C_RAT Alpha-2C adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2c PE=2 SV=2
3	Q01337	0.0	681	458	0.900	0.908	ADA2C_MOUSE Alpha-2C adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2c PE=3 SV=1
4	Q90WY6	0.0	525	432	0.587	0.627	ADA2C_DANRE Alpha-2C adrenergic receptor OS=Danio rerio OX=7955 GN=adra2c PE=3 SV=1
5	A0A060YLN9	6.79e-171	487	380	0.552	0.671	A0A060YLN9_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00008424001 PE=3 SV=1
6	P22909	3.29e-150	437	465	0.537	0.533	ADA2A_RAT Alpha-2A adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2a PE=1 SV=3
7	P18871	1.99e-148	433	465	0.537	0.533	ADA2A_PIG Alpha-2A adrenergic receptor OS=Sus scrofa OX=9823 GN=ADRA2A PE=1 SV=2
8	A0A060X727	3.63e-148	429	388	0.485	0.577	A0A060X727_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00020782001 PE=3 SV=1
9	A0A060YRM0	3.80e-148	429	395	0.487	0.570	A0A060YRM0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023164001 PE=3 SV=1
10	A0A060W6G8	1.36e-147	428	390	0.496	0.587	A0A060W6G8_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00082532001 PE=3 SV=1
11	P08913	2.14e-147	430	465	0.530	0.527	ADA2A_HUMAN Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=4
12	Q01338	3.80e-147	429	465	0.530	0.527	ADA2A_MOUSE Alpha-2A adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2a PE=1 SV=2
13	A0A060W139	1.30e-146	425	390	0.496	0.587	A0A060W139_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077426001 PE=3 SV=1
14	A0A060Y1K1	1.37e-145	423	405	0.483	0.551	A0A060Y1K1_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00043261001 PE=3 SV=1
15	A0A060X9D7	3.23e-142	417	484	0.515	0.492	A0A060X9D7_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00051689001 PE=3 SV=1
16	A0A060XV00	1.05e-140	414	489	0.494	0.466	A0A060XV00_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00044866001 PE=3 SV=1
17	Q8JG69	1.30e-139	409	415	0.476	0.530	AA2DB_DANRE Alpha-2Db adrenergic receptor OS=Danio rerio OX=7955 GN=adra2db PE=3 SV=1
18	P30545	1.70e-138	407	453	0.502	0.512	ADA2B_MOUSE Alpha-2B adrenergic receptor OS=Mus musculus OX=10090 GN=Adra2b PE=1 SV=3
19	P19328	4.33e-138	406	453	0.502	0.512	ADA2B_RAT Alpha-2B adrenergic receptor OS=Rattus norvegicus OX=10116 GN=Adra2b PE=1 SV=2
20	A0A060YPY0	5.78e-138	403	384	0.502	0.604	A0A060YPY0_ONCMY G-protein coupled receptors family 1 profile domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00028829001 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00001 7tm_1	6.1e-70	247.1	7 transmembrane receptor (rhodopsin family)
2	PF13853 7tm_4	0.0045	28.4	Olfactory receptor
3	PF10320 7TM_GPCR_Srsx	1.8e-05	35.9	Serpentine type 7TM GPCR chemoreceptor Srsx
4	PF19180 DUF5862	5.5e+02	11.9	Family of unknown function (DUF5862)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000022524

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000003533	0.867	Guanine nucleotide binding protein (G protein), q polypeptide
2	61853.ENSNLEP00000002743	0.735	Guanine nucleotide-binding protein subunit gamma
3	61853.ENSNLEP00000012941	0.692	Guanine nucleotide binding protein (G protein) alpha 12
4	61853.ENSNLEP00000018099	0.692	G protein subunit alpha 13
5	61853.ENSNLEP00000008489	0.689	G protein subunit alpha i2
6	61853.ENSNLEP00000007896	0.676	G protein subunit beta 5
7	61853.ENSNLEP00000001142	0.662	Regulator of G-protein signaling 20
8	61853.ENSNLEP00000005751	0.625	G protein subunit beta 3
9	61853.ENSNLEP00000024213	0.624	Guanine nucleotide-binding protein subunit gamma
10	61853.ENSNLEP00000001286	0.614	Adenylate cyclase 3
11	61853.ENSNLEP00000000587	0.612	Bradykinin receptor B2
12	61853.ENSNLEP00000010282	0.612	Guanine nucleotide binding protein (G protein), gamma 13
13	61853.ENSNLEP00000000177	0.608	G protein subunit beta 1
14	61853.ENSNLEP00000003554	0.603	Guanine nucleotide-binding protein subunit gamma
15	61853.ENSNLEP00000022824	0.603	Guanine nucleotide-binding protein subunit gamma
16	61853.ENSNLEP00000003373	0.601	Guanine nucleotide-binding protein subunit gamma
17	61853.ENSNLEP00000018786	0.594	G protein subunit alpha z
18	61853.ENSNLEP00000003593	0.583	G protein subunit alpha i3
19	61853.ENSNLEP00000011705	0.583	G protein subunit alpha i1
20	61853.ENSNLEP00000011922	0.580	Adenylate cyclase 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004936	0.999	alpha-adrenergic receptor activity
GO:0005515	0.987	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0007165	0.991	signal transduction
GO:0007186	0.960	G protein-coupled receptor signaling pathway
GO:0048519	0.440	negative regulation of biological process
GO:0032501	0.425	multicellular organismal process
GO:0048583	0.333	regulation of response to stimulus
GO:0065008	0.313	regulation of biological quality
GO:0023051	0.312	regulation of signaling
GO:0010646	0.312	regulation of cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043226	0.971	organelle
GO:0005622	0.941	intracellular anatomical structure
GO:0005737	0.922	cytoplasm
GO:0031982	0.838	vesicle
GO:0043229	0.808	intracellular organelle
GO:0043231	0.771	intracellular membrane-bounded organelle
GO:0012505	0.374	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]