StarFunc result for job id P18846

User Input

>input (271 residues)
MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILAR
RPSYRKILKDLSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQL
ASPGTDGVQGLQTLTMTNSGSTQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQ
IRTTPSATSLPQTVVMTSPVTLTSQTTKTDDPQLKREIRLMKNREAARECRRKKKEYVKC
LENRVAVLENQNKTLIEELKTLKDLYSNKSV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3KR79	0.344	0.287	1.307E-28	355	0.919	0.701	Q3KR79.pdb.gz	Q3KR79_RAT Atf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Atf1 PE=2 SV=1
2	AFDB:F8VYN3	0.302	0.386	2.172E-23	200	0.738	1.000	F8VYN3.pdb.gz	F8VYN3_HUMAN Activating transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=1
3	AFDB:Q803K8	0.476	0.419	1.942E-21	318	0.624	0.531	Q803K8.pdb.gz	Q803K8_DANRE Creb1 protein OS=Danio rerio OX=7955 GN=creb1 PE=1 SV=1
4	AFDB:P27699	0.369	0.296	1.395E-13	357	0.517	0.392	P27699.pdb.gz	CREM_MOUSE cAMP-responsive element modulator OS=Mus musculus OX=10090 GN=Crem PE=1 SV=2
5	AFDB:P18870	0.211	0.184	6.347E-2	314	0.159	0.137	P18870.pdb.gz	JUN_CHICK Transcription factor Jun OS=Gallus gallus OX=9031 GN=JUN PE=1 SV=2
6	AFDB:Q5RH85	0.215	0.099	1.355E-1	653	0.240	0.100	Q5RH85.pdb.gz	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
7	AFDB:P42775	0.222	0.170	4.107E-1	360	0.221	0.167	P42775.pdb.gz	GBF2_ARATH G-box-binding factor 2 OS=Arabidopsis thaliana OX=3702 GN=GBF2 PE=1 SV=1
8	AFDB:Q84JK2	0.229	0.218	4.616E-1	285	0.173	0.165	Q84JK2.pdb.gz	FD_ARATH Protein FD OS=Arabidopsis thaliana OX=3702 GN=FD PE=1 SV=1
9	AFDB:P42776	0.210	0.152	5.187E-1	382	0.207	0.147	P42776.pdb.gz	GBF3_ARATH G-box-binding factor 3 OS=Arabidopsis thaliana OX=3702 GN=GBF3 PE=1 SV=2
10	PDB:7oa6B	0.082	0.124	5.699E-1	152	0.059	0.105	7oa6B.pdb.gz	Phosphorylation activates the yeast small heat shock protein Hsp26 by weakening domain contacts in the oligomer ensemble.
11	AFDB:B8ZZU6	0.214	0.150	5.829E-1	389	0.192	0.134	B8ZZU6.pdb.gz	B8ZZU6_HUMAN Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2 PE=1 SV=1
12	PDB:6xt9I	0.118	0.054	8.088E-1	767	0.026	0.009	6xt9I.pdb.gz
13	PDB:7fikj	0.112	0.043	9.635E-1	1028	0.059	0.016	7fikj.pdb.gz
14	PDB:7wb4j	0.091	0.037	1.217	995	0.052	0.014	7wb4j.pdb.gz
15	PDB:1gvpA	0.070	0.130	1.290	87	0.030	0.092	1gvpA.pdb.gz
16	PDB:6fhmA	0.146	0.189	1.367	193	0.074	0.104	6fhmA.pdb.gz
17	PDB:7f5yB	0.055	0.123	1.367	120	0.037	0.083	7f5yB.pdb.gz
18	PDB:6f2rA	0.078	0.140	1.450	130	0.037	0.077	6f2rA.pdb.gz	Terminal Regions Confer Plasticity to the Tetrameric Assembly of Human HspB2 and HspB3.
19	PDB:7nkyO	0.080	0.062	1.450	427	0.037	0.023	7nkyO.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
20	PDB:6xt9A	0.102	0.052	1.537	567	0.074	0.035	6xt9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18846	0.0	548	271	1.000	1.000	ATF1_HUMAN Cyclic AMP-dependent transcription factor ATF-1 OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=2
2	P81269	4.51e-166	462	269	0.911	0.918	ATF1_MOUSE Cyclic AMP-dependent transcription factor ATF-1 OS=Mus musculus OX=10090 GN=Atf1 PE=1 SV=1
3	F7FD47	2.59e-164	457	268	0.923	0.933	F7FD47_RAT Activating transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Atf1 PE=4 SV=1
4	Q5BK34	4.92e-162	455	348	0.923	0.718	Q5BK34_RAT Atf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Atf1 PE=2 SV=1
5	Q3KR79	7.35e-162	455	355	0.923	0.704	Q3KR79_RAT Atf1 protein (Fragment) OS=Rattus norvegicus OX=10116 GN=Atf1 PE=2 SV=1
6	F8VYN3	7.23e-142	398	200	0.738	1.000	F8VYN3_HUMAN Activating transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=1
7	F8VS03	5.47e-119	339	170	0.627	1.000	F8VS03_HUMAN Activating transcription factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=ATF1 PE=1 SV=1
8	P16220	3.08e-109	320	327	0.627	0.520	CREB1_HUMAN Cyclic AMP-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=3
9	Q53X93	3.08e-109	320	327	0.627	0.520	Q53X93_HUMAN CREB1 protein (Fragment) OS=Homo sapiens OX=9606 GN=CREB1 PE=2 SV=1
10	P15337	4.05e-109	320	327	0.627	0.520	CREB1_RAT Cyclic AMP-responsive element-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Creb1 PE=1 SV=2
11	Q01147	4.05e-109	320	327	0.627	0.520	CREB1_MOUSE Cyclic AMP-responsive element-binding protein 1 OS=Mus musculus OX=10090 GN=Creb1 PE=1 SV=2
12	Q5U0J5	1.08e-108	319	341	0.609	0.484	Q5U0J5_HUMAN cAMP responsive element binding protein 1 OS=Homo sapiens OX=9606 GN=CREB1 PE=2 SV=1
13	Q9W618	3.05e-108	318	327	0.620	0.514	Q9W618_TAEGU CREB OS=Taeniopygia guttata OX=59729 PE=2 SV=1
14	Q803K8	3.62e-107	315	318	0.624	0.531	Q803K8_DANRE Creb1 protein OS=Danio rerio OX=7955 GN=creb1 PE=1 SV=1
15	C9J896	7.88e-83	250	251	0.509	0.550	C9J896_HUMAN cAMP responsive element binding protein 1 (Fragment) OS=Homo sapiens OX=9606 GN=CREB1 PE=1 SV=1
16	Q03060	2.30e-81	250	345	0.554	0.435	CREM_HUMAN cAMP-responsive element modulator OS=Homo sapiens OX=9606 GN=CREM PE=1 SV=6
17	Q03061	5.24e-80	247	357	0.546	0.415	CREM_RAT cAMP-responsive element modulator OS=Rattus norvegicus OX=10116 GN=Crem PE=1 SV=2
18	P27699	5.53e-80	247	357	0.546	0.415	CREM_MOUSE cAMP-responsive element modulator OS=Mus musculus OX=10090 GN=Crem PE=1 SV=2
19	Q9U2I0	1.37e-26	107	327	0.173	0.144	CREBH_CAEEL CREB homolog crh-1 OS=Caenorhabditis elegans OX=6239 GN=crh-1 PE=1 SV=2
20	Q9VWW0	5.77e-26	106	359	0.181	0.136	CREBB_DROME Cyclic AMP response element-binding protein B OS=Drosophila melanogaster OX=7227 GN=CrebB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08687 ASD2	2.2e+02	12.8	Apx/Shroom domain ASD2
2	PF00170 bZIP_1	6.4e-18	75.9	bZIP transcription factor
3	PF07716 bZIP_2	2.4e-05	35.6	Basic region leucine zipper
4	PF03131 bZIP_Maf	1.3	21.0	bZIP Maf transcription factor
5	PF02173 pKID	6.7e-15	65.6	pKID domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262053

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479667	0.984	Ribosomal protein S6 kinase alpha-5
2	9606.ENSP00000333896	0.940	Ribosomal protein S6 kinase alpha-4
3	9606.ENSP00000264110	0.934	Cyclic AMP-dependent transcription factor ATF-2
4	9606.ENSP00000229795	0.926	Mitogen-activated protein kinase 14
5	9606.ENSP00000387699	0.926	Cyclic AMP-responsive element-binding protein 1
6	9606.ENSP00000329140	0.921	Cyclic AMP-responsive element-binding protein 3-like protein 2
7	9606.ENSP00000249330	0.900	Neurosecretory protein VGF
8	9606.ENSP00000342136	0.845	Cyclic AMP-responsive element-binding protein 3
9	9606.ENSP00000357596	0.838	Cyclic AMP-responsive element-binding protein 3-like protein 4
10	9606.ENSP00000336790	0.834	Cyclic AMP-dependent transcription factor ATF-4
11	9606.ENSP00000350359	0.822	Cyclic AMP-responsive element-binding protein 5
12	9606.ENSP00000078445	0.821	Cyclic AMP-responsive element-binding protein 3-like protein 3
13	9606.ENSP00000481956	0.810	Cyclic AMP-responsive element-binding protein 3-like protein 1
14	9606.ENSP00000262367	0.806	CREB-binding protein
15	9606.ENSP00000364349	0.800	Cyclic AMP-dependent transcription factor ATF-6 beta
16	9606.ENSP00000254108	0.764	RNA-binding protein FUS
17	9606.ENSP00000356070	0.741	MAP kinase-activated protein kinase 2
18	9606.ENSP00000256460	0.720	Calcium/calmodulin-dependent protein kinase type 1
19	9606.ENSP00000239938	0.711	Early growth response protein 1
20	9606.ENSP00000396467	0.711	MAP kinase-activated protein kinase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000981	1.000	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0043565	1.000	sequence-specific DNA binding
GO:0005515	0.995	protein binding
GO:0003690	0.975	double-stranded DNA binding
GO:0000976	0.966	transcription cis-regulatory region binding
GO:0044877	0.949	protein-containing complex binding
GO:0000977	0.820	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0001228	0.341	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000987	0.307	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0045893	0.995	positive regulation of DNA-templated transcription
GO:0009987	0.992	cellular process
GO:0006357	0.986	regulation of transcription by RNA polymerase II
GO:0045944	0.960	positive regulation of transcription by RNA polymerase II
GO:0042221	0.956	response to chemical
GO:0010033	0.902	response to organic substance
GO:0051716	0.866	cellular response to stimulus
GO:0007165	0.779	signal transduction
GO:0008152	0.511	metabolic process
GO:0010035	0.442	response to inorganic substance
GO:0071704	0.425	organic substance metabolic process
GO:0014070	0.416	response to organic cyclic compound
GO:0048519	0.390	negative regulation of biological process
GO:0044238	0.387	primary metabolic process
GO:0044237	0.380	cellular metabolic process
GO:0006807	0.342	nitrogen compound metabolic process
GO:0070887	0.337	cellular response to chemical stimulus
GO:0071840	0.323	cellular component organization or biogenesis
GO:0048523	0.319	negative regulation of cellular process
GO:0035556	0.302	intracellular signal transduction
GO:0009892	0.300	negative regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.999	protein-containing complex
GO:0005634	0.999	nucleus
GO:0070013	0.995	intracellular organelle lumen
GO:0005654	0.990	nucleoplasm
GO:0005667	0.988	transcription regulator complex
GO:0140513	0.831	nuclear protein-containing complex
GO:0090575	0.474	RNA polymerase II transcription regulator complex
GO:0005829	0.381	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]