StarFunc result for job id P18847

User Input

>input (181 residues)
MMLQHPGQVSASEVSASAIVPCLSPPGSLVFEDFANLTPFVKEELRFAIQNKHLCHRMSS
ALESVTVSDRPLGVSITKAEVAPEEDERKKRRRERNKIAAAKCRNKKKEKTECLQKESEK
LESVNAELKAQIEELKNEKQHLIYMLNLHRPTCIVRAQNGRTPEDERNLFIQQIKEGTLQ
S

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18847	1.000	1.000	6.725E-28	181	1.000	1.000	P18847.pdb.gz	ATF3_HUMAN Cyclic AMP-dependent transcription factor ATF-3 OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=2
2	AFDB:Q7ZVX7	0.630	0.569	3.516E-16	202	0.718	0.644	Q7ZVX7.pdb.gz	Q7ZVX7_DANRE Activating transcription factor 3 OS=Danio rerio OX=7955 GN=zgc:55526 PE=2 SV=1
3	AFDB:A7S4U5	0.404	0.359	5.410E-2	205	0.320	0.283	A7S4U5.pdb.gz	A7S4U5_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g232694 PE=1 SV=1
4	AFDB:A7SDT1	0.389	0.124	1.070E-1	598	0.276	0.084	A7SDT1.pdb.gz	A7SDT1_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g244559 PE=1 SV=1
5	AFDB:Q9FF75	0.305	0.138	2.657E-1	471	0.160	0.062	Q9FF75.pdb.gz	SUN1_ARATH SUN domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=SUN1 PE=1 SV=1
6	AFDB:Q09771	0.385	0.339	3.336E-1	209	0.193	0.167	Q09771.pdb.gz	ATF31_SCHPO Transcription factor atf31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=atf31 PE=3 SV=1
7	AFDB:Q29PT3	0.233	0.265	6.599E-1	156	0.227	0.263	Q29PT3.pdb.gz	Q29PT3_ARATH At3g49760 OS=Arabidopsis thaliana OX=3702 GN=BZIP5 PE=1 SV=1
8	AFDB:F1Q689	0.212	0.106	7.118E-1	426	0.171	0.073	F1Q689.pdb.gz
9	AFDB:P93008	0.371	0.111	7.118E-1	733	0.149	0.037	P93008.pdb.gz	RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana OX=3702 GN=RH21 PE=2 SV=1
10	AFDB:F1QFU0	0.290	0.071	1.040	935	0.182	0.035	F1QFU0.pdb.gz	TMC1_DANRE Transmembrane channel-like protein 1 OS=Danio rerio OX=7955 GN=tmc1 PE=1 SV=2
11	PDB:6zdbA	0.141	0.191	3.357	129	0.077	0.109	6zdbA.pdb.gz
12	PDB:5o9zP	0.124	0.216	4.546	91	0.077	0.154	5o9zP.pdb.gz	Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.
13	PDB:6qldY	0.210	0.175	4.546	223	0.116	0.094	6qldY.pdb.gz	Structure of the inner kinetochore CCAN complex assembled onto a centromeric nucleosome.
14	PDB:7qooH	0.232	0.202	4.904	210	0.116	0.100	7qooH.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
15	PDB:6rlbD	0.123	0.060	5.290	446	0.055	0.022	6rlbD.pdb.gz
16	PDB:7c4jH	0.186	0.144	5.706	242	0.110	0.083	7c4jH.pdb.gz
17	PDB:7nvr3	0.100	0.091	6.156	214	0.050	0.042	7nvr3.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
18	PDB:7yyhK	0.234	0.201	6.156	217	0.149	0.124	7yyhK.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
19	PDB:6exnO	0.159	0.099	7.163	320	0.155	0.087	6exnO.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
20	PDB:6lthQ	0.263	0.422	8.335	105	0.122	0.210	6lthQ.pdb.gz	Structure of nucleosome-bound human BAF complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18847	2.17e-132	369	181	1.000	1.000	ATF3_HUMAN Cyclic AMP-dependent transcription factor ATF-3 OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=2
2	Q5VTZ4	1.31e-127	357	175	0.967	1.000	Q5VTZ4_HUMAN Activating transcription factor 3 (Fragment) OS=Homo sapiens OX=9606 GN=ATF3 PE=1 SV=1
3	P29596	4.59e-117	331	181	0.950	0.950	ATF3_RAT Cyclic AMP-dependent transcription factor ATF-3 OS=Rattus norvegicus OX=10116 GN=Atf3 PE=2 SV=1
4	Q60765	1.45e-116	330	181	0.950	0.950	ATF3_MOUSE Cyclic AMP-dependent transcription factor ATF-3 OS=Mus musculus OX=10090 GN=Atf3 PE=2 SV=1
5	Q7ZVX7	3.16e-79	236	202	0.729	0.653	Q7ZVX7_DANRE Activating transcription factor 3 OS=Danio rerio OX=7955 GN=zgc:55526 PE=2 SV=1
6	P97875	5.18e-31	112	163	0.475	0.528	JDP2_MOUSE Jun dimerization protein 2 OS=Mus musculus OX=10090 GN=Jdp2 PE=1 SV=2
7	Q78E65	5.18e-31	112	163	0.475	0.528	JDP2_RAT Jun dimerization protein 2 OS=Rattus norvegicus OX=10116 GN=Jdp2 PE=1 SV=1
8	Q8WYK2	2.89e-30	110	163	0.293	0.325	JDP2_HUMAN Jun dimerization protein 2 OS=Homo sapiens OX=9606 GN=JDP2 PE=1 SV=1
9	F6WD51	4.24e-20	86.7	273	0.298	0.198	F6WD51_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=atf3 PE=1 SV=2
10	Q6P0S4	1.71e-16	77.8	349	0.199	0.103	Q6P0S4_DANRE Proto-oncogene c-Fos OS=Danio rerio OX=7955 GN=fos PE=2 SV=1
11	Q4H3J9	8.13e-15	73.6	501	0.221	0.080	Q4H3J9_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-Fos PE=1 SV=1
12	A7S4U5	1.15e-14	70.9	205	0.309	0.273	A7S4U5_NEMVE BZIP domain-containing protein OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g232694 PE=1 SV=1
13	A8MPH9	4.97e-13	68.6	722	0.177	0.044	FOSLD_DROME Transcription factor kayak, isoforms D/sro OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=2
14	P21525	5.01e-13	68.6	755	0.177	0.042	FOSLA_DROME Transcription factor kayak, isoforms A/B/F OS=Drosophila melanogaster OX=7227 GN=kay PE=1 SV=4
15	A2RUX8	3.17e-12	65.9	341	0.177	0.094	A2RUX8_DANRE FOS-like 2, AP-1 transcription factor subunit OS=Danio rerio OX=7955 GN=zgc:158347 PE=2 SV=1
16	Q16520	5.07e-12	62.0	125	0.177	0.256	BATF_HUMAN Basic leucine zipper transcriptional factor ATF-like OS=Homo sapiens OX=9606 GN=BATF PE=1 SV=1
17	A7SB15	6.39e-12	60.5	70	0.188	0.486	A7SB15_NEMVE BZIP domain-containing protein (Fragment) OS=Nematostella vectensis OX=45351 GN=NEMVEDRAFT_v1g29743 PE=1 SV=1
18	P10158	8.89e-12	63.9	275	0.215	0.142	FOSL1_RAT Fos-related antigen 1 OS=Rattus norvegicus OX=10116 GN=Fosl1 PE=2 SV=1
19	P48755	9.96e-12	63.9	273	0.221	0.147	FOSL1_MOUSE Fos-related antigen 1 OS=Mus musculus OX=10090 GN=Fosl1 PE=1 SV=2
20	O35284	1.01e-11	61.2	125	0.177	0.256	BATF_MOUSE Basic leucine zipper transcriptional factor ATF-like OS=Mus musculus OX=10090 GN=Batf PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07792 Afi1	1.7e+02	14.1	Docking domain of Afi1 for Arf3 in vesicle trafficking
2	PF00170 bZIP_1	3e-08	44.9	bZIP transcription factor
3	PF07716 bZIP_2	1.2e-06	39.8	Basic region leucine zipper
4	PF03131 bZIP_Maf	0.00024	32.9	bZIP Maf transcription factor
5	PF12709 Fungal_TACC	7.8e+02	11.9	Fungal Transforming acidic coiled-coil (TACC) proteins
6	PF19994 GASH	89	13.8	GTPase-associated system helical domain
7	PF01159 Ribosomal_L6e	5.7e+02	12.5	Ribosomal protein L6e
8	PF08432 Vfa1	20	17.0	AAA-ATPase Vps4-associated protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000024214

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000017965	0.998	Jun proto-oncogene, AP-1 transcription factor subunit
2	61853.ENSNLEP00000021003	0.971	DNA damage-inducible transcript 3 protein
3	61853.ENSNLEP00000011861	0.910	Cellular tumor antigen p53
4	61853.ENSNLEP00000015776	0.897	Mothers against decapentaplegic homolog
5	61853.ENSNLEP00000023491	0.881	Activating transcription factor 4
6	61853.ENSNLEP00000004551	0.868	MDM2 proto-oncogene, E3 ubiquitin protein ligase
7	61853.ENSNLEP00000014415	0.864	Mothers against decapentaplegic homolog
8	61853.ENSNLEP00000022005	0.856	BTG family, member 2
9	61853.ENSNLEP00000003167	0.854	Histone deacetylase 1
10	61853.ENSNLEP00000013544	0.841	Kruppel-like factor 6
11	61853.ENSNLEP00000019981	0.830	Fos proto-oncogene, AP-1 transcription factor subunit
12	61853.ENSNLEP00000005672	0.813	Protein phosphatase 1, regulatory subunit 15A
13	61853.ENSNLEP00000004169	0.786	Gamma-glutamylcyclotransferase
14	61853.ENSNLEP00000013966	0.754	Mothers against decapentaplegic homolog
15	61853.ENSNLEP00000008684	0.727	cAMP responsive element binding protein 1
16	61853.ENSNLEP00000015855	0.713	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
17	61853.ENSNLEP00000009627	0.694	Histone deacetylase 6
18	61853.ENSNLEP00000010928	0.668	Early growth response protein
19	61853.ENSNLEP00000008679	0.655	Kruppel-like factor 7 (ubiquitous)
20	61853.ENSNLEP00000007294	0.632	Nuclear factor, erythroid 2-like 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001227	1.000	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	1.000	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0042802	0.996	identical protein binding
GO:0046982	0.991	protein heterodimerization activity
GO:0001228	0.991	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0042803	0.918	protein homodimerization activity
GO:0000987	0.595	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.554	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0010556	0.997	regulation of macromolecule biosynthetic process
GO:0051252	0.997	regulation of RNA metabolic process
GO:0006355	0.987	regulation of DNA-templated transcription
GO:0009987	0.976	cellular process
GO:0009893	0.975	positive regulation of metabolic process
GO:0010604	0.974	positive regulation of macromolecule metabolic process
GO:0050896	0.970	response to stimulus
GO:0006357	0.965	regulation of transcription by RNA polymerase II
GO:0048522	0.956	positive regulation of cellular process
GO:0048519	0.930	negative regulation of biological process
GO:0048523	0.916	negative regulation of cellular process
GO:0051173	0.905	positive regulation of nitrogen compound metabolic process
GO:0051716	0.867	cellular response to stimulus
GO:0051172	0.852	negative regulation of nitrogen compound metabolic process
GO:0010605	0.852	negative regulation of macromolecule metabolic process
GO:0031324	0.850	negative regulation of cellular metabolic process
GO:0031325	0.846	positive regulation of cellular metabolic process
GO:0006950	0.844	response to stress
GO:0009891	0.835	positive regulation of biosynthetic process
GO:0009890	0.832	negative regulation of biosynthetic process
GO:0045893	0.827	positive regulation of DNA-templated transcription
GO:0010558	0.803	negative regulation of macromolecule biosynthetic process
GO:0031327	0.803	negative regulation of cellular biosynthetic process
GO:0042221	0.769	response to chemical
GO:0045934	0.765	negative regulation of nucleobase-containing compound metabolic process
GO:0045892	0.748	negative regulation of DNA-templated transcription
GO:0045944	0.711	positive regulation of transcription by RNA polymerase II
GO:0048583	0.693	regulation of response to stimulus
GO:0000122	0.662	negative regulation of transcription by RNA polymerase II
GO:0070887	0.644	cellular response to chemical stimulus
GO:0009966	0.617	regulation of signal transduction
GO:0033554	0.610	cellular response to stress
GO:0007154	0.565	cell communication
GO:0008152	0.512	metabolic process
GO:0032502	0.480	developmental process
GO:0023052	0.457	signaling
GO:0048584	0.427	positive regulation of response to stimulus
GO:0007165	0.425	signal transduction
GO:0071704	0.409	organic substance metabolic process
GO:0044238	0.407	primary metabolic process
GO:0010941	0.376	regulation of cell death
GO:0048856	0.372	anatomical structure development
GO:0042981	0.359	regulation of apoptotic process
GO:0010033	0.314	response to organic substance

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0032991	0.987	protein-containing complex
GO:0140513	0.919	nuclear protein-containing complex
GO:0005667	0.883	transcription regulator complex
GO:0090575	0.813	RNA polymerase II transcription regulator complex
GO:0005730	0.606	nucleolus
GO:0005737	0.601	cytoplasm
GO:0005829	0.503	cytosol
GO:1990622	0.384	CHOP-ATF3 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]