StarFunc result for job id P18848

User Input

>input (351 residues)
MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSE
WLAVDGLVSPSNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTC
DLFAPLVQETNKQPPQTVNPIGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSL
ELGSEVDITEGDRKPDYTAYVAMIPQCIKEEDTPSDNDSGICMSPESYLGSPQHSPSTRG
SPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDKKLKKMEQNKTAATRYRQKKR
AEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRVP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18848	1.000	1.000	2.343E-51	351	1.000	1.000	P18848.pdb.gz	ATF4_HUMAN Cyclic AMP-dependent transcription factor ATF-4 OS=Homo sapiens OX=9606 GN=ATF4 PE=1 SV=3
2	AFDB:Q06507	0.309	0.310	1.087E-40	349	0.863	0.868	Q06507.pdb.gz	ATF4_MOUSE Cyclic AMP-dependent transcription factor ATF-4 OS=Mus musculus OX=10090 GN=Atf4 PE=1 SV=2
3	AFDB:Q4H3V8	0.206	0.217	1.155E-6	340	0.242	0.250	Q4H3V8.pdb.gz	Q4H3V8_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF4/5 PE=1 SV=1
4	AFDB:Q96E09	0.085	0.091	5.531E-3	287	0.128	0.157	Q96E09.pdb.gz	PBIR1_HUMAN PPP2R1A-PPP2R2A-interacting phosphatase regulator 1 OS=Homo sapiens OX=9606 GN=PABIR1 PE=1 SV=1
5	AFDB:Q18452	0.209	0.150	2.326E-2	512	0.171	0.117	Q18452.pdb.gz	MAP9_CAEEL Protein maph-9 OS=Caenorhabditis elegans OX=6239 GN=maph-9 PE=2 SV=2
6	AFDB:Q2PE13	0.203	0.190	4.438E-2	381	0.168	0.155	Q2PE13.pdb.gz	Q2PE13_DROME Activating transcription factor-2 OS=Drosophila melanogaster OX=7227 GN=Atf-2 PE=4 SV=1
7	AFDB:Q96C92	0.209	0.171	6.356E-2	435	0.179	0.145	Q96C92.pdb.gz	ENTR1_HUMAN Endosome-associated-trafficking regulator 1 OS=Homo sapiens OX=9606 GN=ENTR1 PE=1 SV=3
8	AFDB:A5A3E0	0.166	0.062	1.400E-1	1075	0.151	0.049	A5A3E0.pdb.gz	POTEF_HUMAN POTE ankyrin domain family member F OS=Homo sapiens OX=9606 GN=POTEF PE=1 SV=2
9	AFDB:Q9BPU3	0.116	0.052	1.505E-1	792	0.128	0.057	Q9BPU3.pdb.gz	KIF2_DICDI Kinesin-related protein 2 OS=Dictyostelium discoideum OX=44689 GN=kif2 PE=2 SV=1
10	AFDB:Q98TA5	0.121	0.052	1.617E-1	896	0.154	0.060	Q98TA5.pdb.gz	CA1AA_XENLA Chromatin assembly factor 1 subunit A-A OS=Xenopus laevis OX=8355 GN=chaf1a-a PE=1 SV=1
11	PDB:7mq8NY	0.057	0.068	8.354	274	0.023	0.029	7mq8NY.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18848	0.0	713	351	1.000	1.000	ATF4_HUMAN Cyclic AMP-dependent transcription factor ATF-4 OS=Homo sapiens OX=9606 GN=ATF4 PE=1 SV=3
2	Q06507	0.0	598	349	0.863	0.868	ATF4_MOUSE Cyclic AMP-dependent transcription factor ATF-4 OS=Mus musculus OX=10090 GN=Atf4 PE=1 SV=2
3	Q9ES19	0.0	607	347	0.872	0.882	ATF4_RAT Cyclic AMP-dependent transcription factor ATF-4 OS=Rattus norvegicus OX=10116 GN=Atf4 PE=1 SV=1
4	O70191	4.35e-21	93.6	283	0.142	0.177	ATF5_MOUSE Cyclic AMP-dependent transcription factor ATF-5 OS=Mus musculus OX=10090 GN=Atf5 PE=1 SV=2
5	Q6P788	4.56e-21	93.6	281	0.142	0.178	ATF5_RAT Cyclic AMP-dependent transcription factor ATF-5 OS=Rattus norvegicus OX=10116 GN=Atf5 PE=1 SV=1
6	Q9Y2D1	7.00e-20	90.5	282	0.125	0.156	ATF5_HUMAN Cyclic AMP-dependent transcription factor ATF-5 OS=Homo sapiens OX=9606 GN=ATF5 PE=1 SV=4
7	Q4H3V8	7.32e-11	64.7	340	0.085	0.088	Q4H3V8_CIOIN Transcription factor protein OS=Ciona intestinalis OX=7719 GN=Ci-ATF4/5 PE=1 SV=1
8	M9PBF8	1.87e-10	63.9	372	0.091	0.086	M9PBF8_DROME Cryptocephal, isoform F OS=Drosophila melanogaster OX=7227 GN=crc PE=4 SV=1
9	Q9VID3	2.04e-10	63.9	381	0.091	0.084	Q9VID3_DROME Cryptocephal, isoform A OS=Drosophila melanogaster OX=7227 GN=crc PE=2 SV=1
10	Q9NIR4	2.07e-10	63.5	373	0.091	0.086	Q9NIR4_DROME CRC-A OS=Drosophila melanogaster OX=7227 GN=crc PE=4 SV=1
11	Q9NIR3	2.33e-10	63.2	298	0.091	0.107	Q9NIR3_DROME CRC-B OS=Drosophila melanogaster OX=7227 GN=crc PE=1 SV=1
12	Q4WNP9	6.20e-05	46.6	305	0.068	0.079	Q4WNP9_ASPFU BZIP transcription factor (MetR), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_4G06530 PE=4 SV=1
13	G5EAW6	1.88e-04	45.1	294	0.066	0.078	G5EAW6_EMENI BZIP domain-containing protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_04361 PE=4 SV=1
14	Q5B2L2	4.58e-04	43.9	279	0.137	0.172	Q5B2L2_EMENI Hypothetical second sulfur transcription regulator MetZ, bZIP transcription factor (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05218 PE=4 SV=1
15	Q8IG69	6.51e-04	40.8	100	0.060	0.210	CEBP2_CAEEL CCAAT/enhancer-binding protein homolog 2 OS=Caenorhabditis elegans OX=6239 GN=cebp-2 PE=1 SV=1
16	A0A1I6CMA8	8.28e-04	43.1	291	0.066	0.079	A0A1I6CMA8_CAEEL BZIP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=zip-9 PE=1 SV=1
17	O24646	0.001	41.6	168	0.066	0.137	HY5_ARATH Transcription factor HY5 OS=Arabidopsis thaliana OX=3702 GN=HY5 PE=1 SV=1
18	O35284	0.001	40.8	125	0.051	0.144	BATF_MOUSE Basic leucine zipper transcriptional factor ATF-like OS=Mus musculus OX=10090 GN=Batf PE=1 SV=1
19	P97876	0.001	41.2	133	0.057	0.150	BATF3_RAT Basic leucine zipper transcriptional factor ATF-like 3 OS=Rattus norvegicus OX=10116 GN=Batf3 PE=1 SV=1
20	Q9D275	0.001	40.8	118	0.054	0.161	BATF3_MOUSE Basic leucine zipper transcriptional factor ATF-like 3 OS=Mus musculus OX=10090 GN=Batf3 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	5.8e-14	63.3	bZIP transcription factor
2	PF07716 bZIP_2	0.00096	30.5	Basic region leucine zipper
3	PF11932 DUF3450	5	17.9	Protein of unknown function (DUF3450)
4	PF14362 DUF4407	1.2e+02	13.4	Domain of unknown function (DUF4407)
5	PF06818 Fez1	3.5e+02	13.0	Fez1
6	PF07767 Nop53	7.5e+02	10.8	Nop53 (60S ribosomal biogenesis)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000336790

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217233	0.998	Tribbles homolog 3
2	9606.ENSP00000448665	0.995	DNA damage-inducible transcript 3 protein
3	9606.ENSP00000324173	0.987	78 kDa glucose-regulated protein
4	9606.ENSP00000256383	0.984	Eukaryotic translation initiation factor 2 subunit 1
5	9606.ENSP00000344352	0.981	Cyclic AMP-dependent transcription factor ATF-3
6	9606.ENSP00000355593	0.979	Disrupted in schizophrenia 1 protein
7	9606.ENSP00000262367	0.976	CREB-binding protein
8	9606.ENSP00000305422	0.976	CCAAT/enhancer-binding protein beta
9	9606.ENSP00000380252	0.974	Nuclear factor erythroid 2-related factor 2
10	9606.ENSP00000263253	0.969	Histone acetyltransferase p300
11	9606.ENSP00000175506	0.967	Asparagine synthetase
12	9606.ENSP00000200453	0.964	Protein phosphatase 1 regulatory subunit 15A
13	9606.ENSP00000307235	0.957	Eukaryotic translation initiation factor 2-alpha kinase 3
14	9606.ENSP00000398105	0.956	Glutathione-specific gamma-glutamylcyclotransferase 1
15	9606.ENSP00000409555	0.951	Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein
16	9606.ENSP00000284000	0.948	CCAAT/enhancer-binding protein gamma
17	9606.ENSP00000360266	0.936	Transcription factor AP-1
18	9606.ENSP00000364119	0.933	Eukaryotic translation initiation factor 2 subunit 2
19	9606.ENSP00000381793	0.931	Growth factor receptor-bound protein 10
20	9606.ENSP00000078445	0.927	Cyclic AMP-responsive element-binding protein 3-like protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:1990841	1.000	promoter-specific chromatin binding
GO:0140297	1.000	DNA-binding transcription factor binding
GO:0000976	1.000	transcription cis-regulatory region binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0042802	0.982	identical protein binding
GO:0061629	0.978	RNA polymerase II-specific DNA-binding transcription factor binding
GO:0019899	0.974	enzyme binding
GO:0030275	0.922	LRR domain binding
GO:0019901	0.910	protein kinase binding
GO:0000977	0.626	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0043522	0.555	leucine zipper domain binding
GO:0000987	0.414	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.389	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.350	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0050896	0.996	response to stimulus
GO:0051716	0.991	cellular response to stimulus
GO:0031325	0.991	positive regulation of cellular metabolic process
GO:0006357	0.991	regulation of transcription by RNA polymerase II
GO:0051173	0.989	positive regulation of nitrogen compound metabolic process
GO:0010604	0.989	positive regulation of macromolecule metabolic process
GO:0007154	0.986	cell communication
GO:0033554	0.983	cellular response to stress
GO:0045893	0.979	positive regulation of DNA-templated transcription
GO:0042221	0.975	response to chemical
GO:0023052	0.970	signaling
GO:0043618	0.970	regulation of transcription from RNA polymerase II promoter in response to stress
GO:0008152	0.969	metabolic process
GO:0045944	0.964	positive regulation of transcription by RNA polymerase II
GO:0070887	0.963	cellular response to chemical stimulus
GO:0034976	0.961	response to endoplasmic reticulum stress
GO:0036003	0.954	positive regulation of transcription from RNA polymerase II promoter in response to stress
GO:0071704	0.953	organic substance metabolic process
GO:0048519	0.953	negative regulation of biological process
GO:0044238	0.951	primary metabolic process
GO:0010941	0.941	regulation of cell death
GO:0048523	0.940	negative regulation of cellular process
GO:0034599	0.933	cellular response to oxidative stress
GO:1901214	0.928	regulation of neuron death
GO:0048583	0.925	regulation of response to stimulus
GO:0044237	0.913	cellular metabolic process
GO:0007165	0.896	signal transduction
GO:0043067	0.895	regulation of programmed cell death
GO:0009991	0.878	response to extracellular stimulus
GO:0031667	0.870	response to nutrient levels
GO:0010033	0.869	response to organic substance
GO:0006807	0.864	nitrogen compound metabolic process
GO:0080135	0.864	regulation of cellular response to stress
GO:0071496	0.862	cellular response to external stimulus
GO:0031669	0.848	cellular response to nutrient levels
GO:0071310	0.840	cellular response to organic substance
GO:0042981	0.774	regulation of apoptotic process
GO:0006986	0.705	response to unfolded protein
GO:0034620	0.701	cellular response to unfolded protein
GO:1990928	0.684	response to amino acid starvation
GO:0034198	0.673	cellular response to amino acid starvation
GO:1900407	0.654	regulation of cellular response to oxidative stress
GO:0060548	0.652	negative regulation of cell death
GO:0051239	0.610	regulation of multicellular organismal process
GO:1901564	0.603	organonitrogen compound metabolic process
GO:0043170	0.568	macromolecule metabolic process
GO:0006984	0.522	ER-nucleus signaling pathway
GO:0032501	0.483	multicellular organismal process
GO:0048856	0.477	anatomical structure development
GO:0009892	0.384	negative regulation of metabolic process
GO:0007275	0.373	multicellular organism development
GO:0050793	0.370	regulation of developmental process
GO:0023051	0.341	regulation of signaling
GO:0010646	0.339	regulation of cell communication
GO:0010628	0.339	positive regulation of gene expression
GO:1903201	0.307	regulation of oxidative stress-induced cell death
GO:0035556	0.307	intracellular signal transduction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0032991	0.996	protein-containing complex
GO:0005829	0.913	cytosol
GO:0140513	0.896	nuclear protein-containing complex
GO:0005667	0.887	transcription regulator complex
GO:0090575	0.757	RNA polymerase II transcription regulator complex
GO:0043232	0.589	intracellular non-membrane-bounded organelle
GO:0120025	0.476	plasma membrane bounded cell projection
GO:0043005	0.447	neuron projection
GO:0005813	0.436	centrosome
GO:0016234	0.434	inclusion body
GO:0034399	0.409	nuclear periphery
GO:0016020	0.377	membrane
GO:0097413	0.376	Lewy body
GO:1990617	0.375	CHOP-ATF4 complex
GO:1990037	0.374	Lewy body core
GO:1990590	0.365	ATF1-ATF4 transcription factor complex
GO:1990589	0.365	ATF4-CREB1 transcription factor complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]