StarFunc result for job id P18850

User Input

>input (670 residues)
MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNL
DFDLDLMPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEE
LDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQ
PKPLLLPAAPKTQTNSSVPAKTIIIQTVPTLMPLAKQQPIISLQPAPTKGQTVLLSQPTV
VQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANSPVNGKLSVTKPVLQSTMRNV
GSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKKENGTLKRQLD
EVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG
FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLN
HELRGWVHRHEVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGS
ELQVYYASPRSYQDFFEAIRRRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAINI
NENVINGQDYEVMMQIDCQVMDTRILHIKSSSVPPYLRDQQRNQTNTFFGSPPAATEATH
VVSTIPESLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18850	1.000	1.000	4.470E-103	670	1.000	1.000	P18850.pdb.gz	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
2	AFDB:F6VAN0	0.558	0.568	6.685E-86	656	0.851	0.869	F6VAN0.pdb.gz	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
3	AFDB:Q5RH85	0.306	0.311	8.614E-45	653	0.431	0.443	Q5RH85.pdb.gz	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
4	AFDB:Q99941	0.289	0.279	3.498E-35	703	0.346	0.330	Q99941.pdb.gz	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
5	AFDB:O35451	0.326	0.314	3.163E-33	699	0.339	0.325	O35451.pdb.gz	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
6	AFDB:A1L224	0.111	0.140	8.250E-6	519	0.166	0.214	A1L224.pdb.gz	CR3L2_DANRE Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Danio rerio OX=7955 GN=creb3l2 PE=2 SV=1
7	AFDB:Q6QDP7	0.113	0.143	1.402E-5	521	0.151	0.194	Q6QDP7.pdb.gz	CR3L2_RAT Cyclic AMP-responsive element-binding protein 3-like protein 2 OS=Rattus norvegicus OX=10116 GN=Creb3l2 PE=2 SV=1
8	AFDB:R4GLV5	0.056	0.036	6.534E-4	1116	0.137	0.082	R4GLV5.pdb.gz
9	AFDB:A0A0C4DG86	0.090	0.090	1.354E-3	668	0.145	0.145	A0A0C4DG86.pdb.gz	A0A0C4DG86_HUMAN Syntabulin OS=Homo sapiens OX=9606 GN=SYBU PE=1 SV=1
10	AFDB:U3JAG9	0.099	0.066	2.300E-3	1113	0.122	0.074	U3JAG9.pdb.gz	CP131_DANRE Centrosomal protein of 131 kDa OS=Danio rerio OX=7955 GN=cep131 PE=1 SV=1
11	PDB:6sgbCK	0.038	0.070	1.989	211	0.025	0.081	6sgbCK.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
12	PDB:7qi4W	0.051	0.198	2.960	116	0.010	0.060	7qi4W.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
13	PDB:6r3aA	0.044	0.070	4.122	323	0.018	0.037	6r3aA.pdb.gz
14	PDB:5z62B	0.034	0.080	5.741	227	0.015	0.044	5z62B.pdb.gz	Structure of the intact 14-subunit human cytochrome c oxidase.
15	PDB:3wanB	0.039	0.115	6.554	128	0.016	0.086	3wanB.pdb.gz
16	PDB:5aj0Ao	0.049	0.188	6.554	105	0.021	0.133	5aj0Ao.pdb.gz	Structural Snapshots of Actively Translating Human Ribosomes
17	PDB:7odrS	0.051	0.130	6.554	161	0.022	0.093	7odrS.pdb.gz	Stepwise maturation of the peptidyl transferase region of human mitoribosomes.
18	PDB:3abkB	0.050	0.141	7.482	227	0.016	0.048	3abkB.pdb.gz	X-ray structure of the NO-bound Cu(B) in bovine cytochrome c oxidase
19	PDB:1ub4C	0.040	0.180	7.994	75	0.018	0.160	1ub4C.pdb.gz
20	PDB:4imaD	0.030	0.041	8.542	460	0.006	0.009	4imaD.pdb.gz	Energetic Coupling between an Oxidizable Cysteine and the Phosphorylatable N-Terminus of Human Liver Pyruvate Kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F6VAN0	0.0	1114	656	0.848	0.866	ATF6A_MOUSE Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Mus musculus OX=10090 GN=Atf6 PE=1 SV=2
2	G3V909	0.0	1106	656	0.861	0.880	ATF6A_RAT Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Rattus norvegicus OX=10116 GN=Atf6 PE=2 SV=1
3	P18850	0.0	1380	670	1.000	1.000	ATF6A_HUMAN Cyclic AMP-dependent transcription factor ATF-6 alpha OS=Homo sapiens OX=9606 GN=ATF6 PE=1 SV=3
4	Q5RH85	3.20e-149	449	653	0.440	0.452	Q5RH85_DANRE Activating transcription factor 6 OS=Danio rerio OX=7955 GN=fi12h10 PE=4 SV=2
5	O35451	1.43e-91	301	699	0.330	0.316	ATF6B_MOUSE Cyclic AMP-dependent transcription factor ATF-6 beta OS=Mus musculus OX=10090 GN=Atf6b PE=1 SV=1
6	Q99941	2.26e-86	287	703	0.252	0.240	ATF6B_HUMAN Cyclic AMP-dependent transcription factor ATF-6 beta OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=2
7	Q20435	5.58e-14	77.4	589	0.130	0.148	ATF6H_CAEEL Transcription factor atf-6 homolog OS=Caenorhabditis elegans OX=6239 GN=atf-6 PE=1 SV=2
8	Q6Z312	1.58e-08	59.3	357	0.052	0.098	BZP23_ORYSJ bZIP transcription factor 23 OS=Oryza sativa subsp. japonica OX=39947 GN=BZIP23 PE=2 SV=1
9	F4JB53	3.01e-08	58.9	432	0.070	0.109	F4JB53_ARATH ABRE binding factor 4 OS=Arabidopsis thaliana OX=3702 GN=ABF4 PE=1 SV=1
10	Q9D2A5	3.81e-08	58.2	370	0.054	0.097	CR3L4_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Mus musculus OX=10090 GN=Creb3l4 PE=1 SV=1
11	Q91XE9	7.06e-08	57.8	479	0.063	0.088	CR3L3_MOUSE Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Mus musculus OX=10090 GN=Creb3l3 PE=1 SV=1
12	Q9M7Q2	9.28e-08	57.4	431	0.064	0.100	AI5L7_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 7 OS=Arabidopsis thaliana OX=3702 GN=ABF4 PE=1 SV=1
13	Q68CJ9	1.30e-07	57.0	461	0.054	0.078	CR3L3_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 3 OS=Homo sapiens OX=9606 GN=CREB3L3 PE=1 SV=2
14	Q8TEY5	6.96e-07	54.3	395	0.049	0.084	CR3L4_HUMAN Cyclic AMP-responsive element-binding protein 3-like protein 4 OS=Homo sapiens OX=9606 GN=CREB3L4 PE=1 SV=1
15	Q9SJN0	1.37e-06	53.5	442	0.057	0.086	ABI5_ARATH Protein ABSCISIC ACID-INSENSITIVE 5 OS=Arabidopsis thaliana OX=3702 GN=ABI5 PE=1 SV=1
16	F4I3C9	3.92e-06	52.0	403	0.045	0.074	F4I3C9_ARATH Abscisic acid responsive element-binding factor 1 OS=Arabidopsis thaliana OX=3702 GN=ABF1 PE=1 SV=1
17	P81269	1.17e-05	49.7	269	0.058	0.145	ATF1_MOUSE Cyclic AMP-dependent transcription factor ATF-1 OS=Mus musculus OX=10090 GN=Atf1 PE=1 SV=1
18	Q69TW5	1.46e-05	50.1	324	0.048	0.099	BZP46_ORYSJ bZIP transcription factor 46 OS=Oryza sativa subsp. japonica OX=39947 GN=BZIP46 PE=1 SV=1
19	F7FD47	1.52e-05	49.3	268	0.058	0.146	F7FD47_RAT Activating transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Atf1 PE=4 SV=1
20	Q9M7Q4	1.67e-05	50.1	416	0.040	0.065	AI5L5_ARATH ABSCISIC ACID-INSENSITIVE 5-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=ABF2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00170 bZIP_1	9.3e-08	43.4	bZIP transcription factor
2	PF07716 bZIP_2	0.012	27.0	Basic region leucine zipper
3	PF03131 bZIP_Maf	2.6	20.0	bZIP Maf transcription factor
4	PF08990 Docking	5.1e+02	11.8	Erythronolide synthase docking domain
5	PF19103 DUF5790	1.3e+02	14.6	Family of unknown function (DUF5790)
6	PF09726 Macoilin	19	15.3	Macoilin family
7	PF04452 Methyltrans_RNA	88	14.1	RNA methyltransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356919

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000324173	0.999	78 kDa glucose-regulated protein
2	9606.ENSP00000216037	0.998	X-box-binding protein 1
3	9606.ENSP00000320866	0.990	Calreticulin
4	9606.ENSP00000448665	0.989	DNA damage-inducible transcript 3 protein
5	9606.ENSP00000299767	0.985	Endoplasmin
6	9606.ENSP00000368798	0.976	Membrane-bound transcription factor site-2 protease
7	9606.ENSP00000344223	0.972	Membrane-bound transcription factor site-1 protease
8	9606.ENSP00000229795	0.954	Mitogen-activated protein kinase 14
9	9606.ENSP00000401445	0.934	Serine/threonine-protein kinase/endoribonuclease IRE1
10	9606.ENSP00000226760	0.924	Wolframin
11	9606.ENSP00000307235	0.924	Eukaryotic translation initiation factor 2-alpha kinase 3
12	9606.ENSP00000333685	0.919	Mitogen-activated protein kinase 11
13	9606.ENSP00000339730	0.906	Thrombospondin-4
14	9606.ENSP00000256383	0.905	Eukaryotic translation initiation factor 2 subunit 1
15	9606.ENSP00000336790	0.904	Cyclic AMP-dependent transcription factor ATF-4
16	9606.ENSP00000417175	0.896	Vesicle-associated membrane protein-associated protein B/C
17	9606.ENSP00000265070	0.865	Golgi phosphoprotein 3
18	9606.ENSP00000364349	0.860	Cyclic AMP-dependent transcription factor ATF-6 beta
19	9606.ENSP00000262238	0.855	Transcriptional repressor protein YY1
20	9606.ENSP00000265354	0.848	Serum response factor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.999	sequence-specific DNA binding
GO:0003700	0.993	DNA-binding transcription factor activity
GO:1990837	0.987	sequence-specific double-stranded DNA binding
GO:0000981	0.982	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.979	transcription cis-regulatory region binding
GO:0001228	0.956	DNA-binding transcription activator activity, RNA polymerase II-specific
GO:0000978	0.954	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0046983	0.928	protein dimerization activity
GO:0042802	0.905	identical protein binding
GO:0046982	0.724	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0006355	0.992	regulation of DNA-templated transcription
GO:0048518	0.990	positive regulation of biological process
GO:0009987	0.985	cellular process
GO:0048522	0.983	positive regulation of cellular process
GO:0050896	0.977	response to stimulus
GO:0051173	0.975	positive regulation of nitrogen compound metabolic process
GO:0010604	0.975	positive regulation of macromolecule metabolic process
GO:0045893	0.972	positive regulation of DNA-templated transcription
GO:0051716	0.970	cellular response to stimulus
GO:0006357	0.967	regulation of transcription by RNA polymerase II
GO:0045944	0.964	positive regulation of transcription by RNA polymerase II
GO:0006950	0.934	response to stress
GO:0042221	0.897	response to chemical
GO:0007165	0.875	signal transduction
GO:0033554	0.873	cellular response to stress
GO:0010033	0.865	response to organic substance
GO:0070887	0.853	cellular response to chemical stimulus
GO:0048583	0.845	regulation of response to stimulus
GO:0009966	0.841	regulation of signal transduction
GO:0034976	0.760	response to endoplasmic reticulum stress
GO:0071310	0.756	cellular response to organic substance
GO:0080134	0.640	regulation of response to stress
GO:0048584	0.540	positive regulation of response to stimulus
GO:0010941	0.433	regulation of cell death
GO:0080135	0.324	regulation of cellular response to stress
GO:0035966	0.307	response to topologically incorrect protein
GO:0006986	0.303	response to unfolded protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	1.000	nucleus
GO:0016020	0.983	membrane
GO:0012505	0.979	endomembrane system
GO:0070013	0.974	intracellular organelle lumen
GO:0032991	0.961	protein-containing complex
GO:0005654	0.918	nucleoplasm
GO:0005829	0.897	cytosol
GO:0031090	0.872	organelle membrane
GO:0005783	0.854	endoplasmic reticulum
GO:0031984	0.843	organelle subcompartment
GO:0005789	0.821	endoplasmic reticulum membrane
GO:0098588	0.760	bounding membrane of organelle
GO:0005667	0.751	transcription regulator complex
GO:0090575	0.744	RNA polymerase II transcription regulator complex
GO:0005794	0.626	Golgi apparatus
GO:0031967	0.592	organelle envelope
GO:0000139	0.431	Golgi membrane
GO:0005635	0.310	nuclear envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]