StarFunc result for job id P18859

User Input

>input (108 residues)
MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGP
VDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18859	1.000	1.000	5.740E-17	108	1.000	1.000	P18859.pdb.gz	ATP5J_HUMAN ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1
2	AFDB:P97450	0.764	0.764	8.366E-15	108	0.806	0.806	P97450.pdb.gz	ATP5J_MOUSE ATP synthase-coupling factor 6, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pf PE=1 SV=1
3	AFDB:P02721	0.768	0.768	4.626E-14	108	0.806	0.806	P02721.pdb.gz	ATP5J_BOVIN ATP synthase-coupling factor 6, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PF PE=1 SV=2
4	AFDB:A8MUH2	0.769	0.706	5.368E-14	119	0.889	0.807	A8MUH2.pdb.gz	A8MUH2_HUMAN ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1
5	AFDB:P21571	0.488	0.488	4.305E-13	108	0.769	0.769	P21571.pdb.gz	ATP5J_RAT ATP synthase-coupling factor 6, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5pf PE=1 SV=1
6	AFDB:Q24407	0.354	0.360	3.252E-6	106	0.426	0.434	Q24407.pdb.gz	ATP5J_DROME ATP synthase-coupling factor 6, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynCF6 PE=3 SV=1
7	AFDB:C1BG59	0.532	0.481	5.093E-5	121	0.324	0.289	C1BG59.pdb.gz	C1BG59_ONCMY ATP synthase-coupling factor 6, mitochondrial OS=Oncorhynchus mykiss OX=8022 GN=ATP5J PE=2 SV=1
8	AFDB:Q8T0Q4	0.280	0.162	5.967E-1	226	0.250	0.119	Q8T0Q4.pdb.gz	Q8T0Q4_DROME GH13992p OS=Drosophila melanogaster OX=7227 GN=shrb PE=1 SV=1
9	AFDB:Q86W67	0.230	0.148	6.427E-1	206	0.148	0.078	Q86W67.pdb.gz	F228A_HUMAN Protein FAM228A OS=Homo sapiens OX=9606 GN=FAM228A PE=1 SV=1
10	AFDB:P39929	0.214	0.111	6.923E-1	240	0.222	0.100	P39929.pdb.gz	SNF7_YEAST Vacuolar-sorting protein SNF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF7 PE=1 SV=1
11	PDB:7vcsA	0.180	0.040	3.127	766	0.157	0.022	7vcsA.pdb.gz	Cryo-EM structures of human p97 double hexamer capture potentiated ATPase-competent state.
12	PDB:7edxc	0.162	0.140	3.628	127	0.185	0.157	7edxc.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
13	PDB:7kzfF	0.186	0.060	3.908	483	0.056	0.012	7kzfF.pdb.gz
14	PDB:7r1dC	0.197	0.122	4.210	192	0.157	0.089	7r1dC.pdb.gz
15	PDB:6v8oO	0.203	0.071	4.885	384	0.130	0.036	6v8oO.pdb.gz	Architecture of the chromatin remodeler RSC and insights into its nucleosome engagement.
16	PDB:6qldY	0.220	0.115	6.577	223	0.167	0.081	6qldY.pdb.gz	Structure of the inner kinetochore CCAN complex assembled onto a centromeric nucleosome.
17	PDB:6yxxAR	0.145	0.077	6.577	267	0.083	0.034	6yxxAR.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
18	PDB:4gwpC	0.221	0.137	7.085	184	0.185	0.109	4gwpC.pdb.gz
19	PDB:2i2xA	0.180	0.058	7.631	459	0.074	0.017	2i2xA.pdb.gz	Insight into the mechanism of biological methanol activation based on the crystal structure of the methanol-cobalamin methyltransferase complex
20	PDB:4yrvA	0.177	0.085	8.220	288	0.074	0.028	4yrvA.pdb.gz	Structural insights into HetR-PatS interaction involved in cyanobacterial pattern formation

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P18859	5.93e-76	221	108	1.000	1.000	ATP5J_HUMAN ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1
2	Q6IB54	5.93e-76	221	108	1.000	1.000	Q6IB54_HUMAN ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5J PE=2 SV=1
3	A8MUH2	1.55e-66	197	119	0.889	0.807	A8MUH2_HUMAN ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1
4	P97450	5.25e-64	191	108	0.806	0.806	ATP5J_MOUSE ATP synthase-coupling factor 6, mitochondrial OS=Mus musculus OX=10090 GN=Atp5pf PE=1 SV=1
5	P02721	7.88e-64	190	108	0.806	0.806	ATP5J_BOVIN ATP synthase-coupling factor 6, mitochondrial OS=Bos taurus OX=9913 GN=ATP5PF PE=1 SV=2
6	P21571	2.77e-60	181	108	0.769	0.769	ATP5J_RAT ATP synthase-coupling factor 6, mitochondrial OS=Rattus norvegicus OX=10116 GN=Atp5pf PE=1 SV=1
7	C1BG59	6.24e-21	82.4	121	0.407	0.364	C1BG59_ONCMY ATP synthase-coupling factor 6, mitochondrial OS=Oncorhynchus mykiss OX=8022 GN=ATP5J PE=2 SV=1
8	Q24407	5.11e-18	74.7	106	0.426	0.434	ATP5J_DROME ATP synthase-coupling factor 6, mitochondrial OS=Drosophila melanogaster OX=7227 GN=ATPsynCF6 PE=3 SV=1
9	P11055	0.11	33.5	1940	0.204	0.011	MYH3_HUMAN Myosin-3 OS=Homo sapiens OX=9606 GN=MYH3 PE=1 SV=3
10	P13541	0.27	32.3	1940	0.194	0.011	MYH3_MOUSE Myosin-3 OS=Mus musculus OX=10090 GN=Myh3 PE=2 SV=2
11	Q91411	0.74	30.8	764	0.204	0.029	Q91411_CHICK Myosin heavy chain (Fragment) OS=Gallus gallus OX=9031 GN=AMHC1 PE=2 SV=1
12	Q910C5	1.1	30.4	1931	0.194	0.011	Q910C5_CHICK Chick atrial myosin heavy chain OS=Gallus gallus OX=9031 PE=2 SV=1
13	Q6NQ74	1.6	30.0	853	0.296	0.038	Q6NQ74_ARATH At5g26910 OS=Arabidopsis thaliana OX=3702 GN=TRM8 PE=1 SV=1
14	P29616	1.8	29.6	1102	0.185	0.018	MYSC_CHICK Myosin heavy chain, cardiac muscle isoform (Fragment) OS=Gallus gallus OX=9031 PE=1 SV=1
15	A0A0G2K1V4	2.7	29.3	1937	0.167	0.009	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
16	F1LRV9	2.7	29.3	1943	0.167	0.009	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
17	P12882	2.8	29.3	1939	0.167	0.009	MYH1_HUMAN Myosin-1 OS=Homo sapiens OX=9606 GN=MYH1 PE=1 SV=3
18	Q5SX40	2.9	29.3	1942	0.167	0.009	MYH1_MOUSE Myosin-1 OS=Mus musculus OX=10090 GN=Myh1 PE=1 SV=1
19	P63139	3.1	28.9	207	0.139	0.072	NFYB_MOUSE Nuclear transcription factor Y subunit beta OS=Mus musculus OX=10090 GN=Nfyb PE=1 SV=1
20	P63140	3.1	28.9	207	0.139	0.072	NFYB_RAT Nuclear transcription factor Y subunit beta OS=Rattus norvegicus OX=10116 GN=Nfyb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05511 ATP-synt_F6	7.2e-42	153.0	Mitochondrial ATP synthase coupling factor 6
2	PF05062 RICH	18	17.1	RICH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000389649

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215375	0.999	ATP synthase subunit delta, mitochondrial
2	9606.ENSP00000243997	0.999	ATP synthase subunit epsilon, mitochondrial
3	9606.ENSP00000262030	0.999	ATP synthase subunit beta, mitochondrial
4	9606.ENSP00000290299	0.999	ATP synthase subunit O, mitochondrial
5	9606.ENSP00000292475	0.999	ATP synthase subunit f, mitochondrial
6	9606.ENSP00000301587	0.999	ATP synthase subunit d, mitochondrial
7	9606.ENSP00000306003	0.999	ATP synthase subunit e, mitochondrial
8	9606.ENSP00000358737	0.999	ATP synthase F(0) complex subunit B1, mitochondrial
9	9606.ENSP00000349142	0.998	ATP synthase subunit gamma, mitochondrial
10	9606.ENSP00000381736	0.998	ATP synthase subunit alpha, mitochondrial
11	9606.ENSP00000377033	0.997	ATP synthase F(0) complex subunit C1, mitochondrial
12	9606.ENSP00000284727	0.996	ATP synthase F(0) complex subunit C3, mitochondrial
13	9606.ENSP00000300688	0.996	ATP synthase subunit g, mitochondrial
14	9606.ENSP00000358840	0.995	Up-regulated during skeletal muscle growth protein 5
15	9606.ENSP00000355265	0.986	ATP synthase protein 8
16	9606.ENSP00000354632	0.984	ATP synthase subunit a
17	9606.ENSP00000367939	0.980	Cytochrome b-c1 complex subunit 8
18	9606.ENSP00000425759	0.978	Cytochrome c oxidase subunit 7C, mitochondrial
19	9606.ENSP00000401770	0.974	6.8 kDa mitochondrial proteolipid
20	9606.ENSP00000417142	0.973	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0005515	0.997	protein binding
GO:0022890	0.996	inorganic cation transmembrane transporter activity
GO:0015078	0.993	proton transmembrane transporter activity
GO:0016874	0.978	ligase activity
GO:0005216	0.976	monoatomic ion channel activity
GO:0005261	0.927	monoatomic cation channel activity
GO:0015252	0.922	proton channel activity
GO:0046933	0.845	proton-transporting ATP synthase activity, rotational mechanism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.960	cellular process
GO:0008152	0.959	metabolic process
GO:0044237	0.946	cellular metabolic process
GO:0046034	0.944	ATP metabolic process
GO:0009060	0.925	aerobic respiration
GO:0015986	0.912	proton motive force-driven ATP synthesis
GO:0032501	0.903	multicellular organismal process
GO:0006119	0.754	oxidative phosphorylation
GO:0032502	0.708	developmental process
GO:0048856	0.699	anatomical structure development
GO:0007275	0.675	multicellular organism development
GO:0048857	0.655	neural nucleus development
GO:0030901	0.655	midbrain development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:1902494	0.996	catalytic complex
GO:0098796	0.996	membrane protein complex
GO:0098798	0.996	mitochondrial protein-containing complex
GO:0098800	0.994	inner mitochondrial membrane protein complex
GO:0016469	0.975	proton-transporting two-sector ATPase complex
GO:0045259	0.965	proton-transporting ATP synthase complex
GO:0005753	0.961	mitochondrial proton-transporting ATP synthase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:6.-.-.-	0.978	Ligases.
RHEA:57720	0.845	ATP + 4 H(+)(in) + H2O = ADP + 5 H(+)(out) + phosphate
EC:7.1.2.2	0.845	H(+)-transporting two-sector ATPase.

[back to server]