StarFunc result for job id P18887

User Input

>input (633 residues)
MPEIRLRHVVSCSSQDSTHCAENLLKADTYRKWRAAKAGEKTISVVLQLEKEEQIHSVDI
GNDGSAFVEVLVGSSAGGAGEQDYEVLLVTSSFMSPSESRSGSNPNRVRMFGPDKLVRAA
AEKRWDRVKIVCSQPYSKDSPFGLSFVRFHSPPDKDEAEAPSQKVTVTKLGQFRVKEEDE
SANSLRPGALFFSRINKTSPVTASDPAGPSYAAATLQASSAASSASPVSRAIGSTSKPQE
SPKGKRKLDLNQEEKKTPSKPPAQLSPSVPKRPKLPAPTRTPATAPVPARAQGAVTGKPR
GEGTEPRRPRAGPEELGKILQGVVVVLSGFQNPFRSELRDKALELGAKYRPDWTRDSTHL
ICAFANTPKYSQVLGLGGRIVRKEWVLDCHRMRRRLPSRRYLMAGPGSSSEEDEASHSGG
SGDEAPKLPQKQPQTKTKPTQAAGPSSPQKPPTPEETKAASPVLQEDIDIEGVQSEGQDN
GAEDSGDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLPVPELP
DFFQGKHFFLYGEFPGDERRKLIRYVTAFNGELEDNMSDRVQFVITAQEWDPSFEEALMD
NPSLAFVRPRWIYSCNEKQKLLPHQLYGVVPQA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P18887	1.000	1.000	0.000	633	1.000	1.000	P18887.pdb.gz	XRCC1_HUMAN DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=3
2	AFDB:O54935	0.457	0.457	3.651E-98	633	0.839	0.839	O54935.pdb.gz	XRCC1_CRIGR DNA repair protein XRCC1 OS=Cricetulus griseus OX=10029 GN=XRCC1 PE=2 SV=1
3	AFDB:Q24JK4	0.155	0.267	1.120E-14	353	0.114	0.204	Q24JK4.pdb.gz	XRCC1_ARATH DNA-repair protein XRCC1 OS=Arabidopsis thaliana OX=3702 GN=XRCC1 PE=1 SV=1
4	AFDB:A0A2R8RVN3	0.137	0.060	2.702E-13	1526	0.130	0.054	A0A2R8RVN3.pdb.gz	A0A2R8RVN3_DANRE DNA topoisomerase 2-binding protein 1 OS=Danio rerio OX=7955 GN=topbp1 PE=1 SV=1
5	PDB:7qe7L	0.179	0.549	4.093E-7	183	0.028	0.098	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
6	PDB:7lsyY	0.207	0.162	6.618E-7	855	0.068	0.050	7lsyY.pdb.gz	Structural basis of long-range to short-range synaptic transition in NHEJ.
7	PDB:1o59A	0.159	0.305	8.935E-7	318	0.039	0.079	1o59A.pdb.gz
8	PDB:1xpwA	0.180	0.720	4.010E-6	143	0.022	0.098	1xpwA.pdb.gz
9	PDB:8a3tA	0.169	0.439	1.695E-5	219	0.033	0.096	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
10	PDB:1k12A	0.166	0.584	3.929E-5	158	0.036	0.146	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.
11	PDB:7kveB	0.157	0.077	2.528E-4	1374	0.024	0.011	7kveB.pdb.gz
12	PDB:7ufgA	0.162	0.093	3.027E-4	1151	0.035	0.019	7ufgA.pdb.gz	Structure of the PAPP-ABP5 complex reveals mechanism of substrate recognition
13	PDB:2vmeA	0.149	0.336	6.223E-4	256	0.027	0.066	2vmeA.pdb.gz	Structure Determination of Discoidin II from Dictyostelium Discoideum and Carbohydrate Binding Properties of the Lectin Domain.
14	PDB:6mdsA	0.158	0.129	7.017E-4	787	0.017	0.014	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
15	AFDB:Q5PSV9	0.114	0.045	1.838E-3	1707	0.134	0.050	Q5PSV9.pdb.gz	MDC1_MOUSE Mediator of DNA damage checkpoint protein 1 OS=Mus musculus OX=10090 GN=Mdc1 PE=1 SV=1
16	AFDB:Q14676	0.124	0.039	2.338E-3	2089	0.106	0.032	Q14676.pdb.gz	MDC1_HUMAN Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3
17	AFDB:Q95RC8	0.120	0.062	2.031E-2	1280	0.084	0.041	Q95RC8.pdb.gz	Q95RC8_DROME LD44171p OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
18	AFDB:B0S8G4	0.080	0.040	2.157E-2	1645	0.125	0.048	B0S8G4.pdb.gz
19	AFDB:O96685	0.120	0.063	3.487E-2	1261	0.095	0.048	O96685.pdb.gz	O96685_DROME Mutator 2 OS=Drosophila melanogaster OX=7227 GN=mu2 PE=1 SV=1
20	AFDB:Q9JIS1	0.051	0.028	1.091E-1	1555	0.103	0.042	Q9JIS1.pdb.gz	RIMS2_RAT Regulating synaptic membrane exocytosis protein 2 OS=Rattus norvegicus OX=10116 GN=Rims2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F5H8D7	0.0	1206	602	0.948	0.997	F5H8D7_HUMAN X-ray repair cross complementing 1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2
2	M0QYS5	0.0	537	292	0.423	0.918	M0QYS5_HUMAN X-ray repair cross complementing 1 (Fragment) OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=1
3	O54935	0.0	971	633	0.840	0.840	XRCC1_CRIGR DNA repair protein XRCC1 OS=Cricetulus griseus OX=10029 GN=XRCC1 PE=2 SV=1
4	P18887	0.0	1289	633	0.997	0.997	XRCC1_HUMAN DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=3
5	Q60596	0.0	1022	631	0.859	0.862	XRCC1_MOUSE DNA repair protein XRCC1 OS=Mus musculus OX=10090 GN=Xrcc1 PE=1 SV=2
6	Q9ESZ0	0.0	997	631	0.864	0.867	XRCC1_RAT DNA repair protein XRCC1 OS=Rattus norvegicus OX=10116 GN=Xrcc1 PE=1 SV=2
7	M0R1U8	1.84e-127	376	210	0.295	0.890	M0R1U8_HUMAN X-ray repair cross complementing 1 (Fragment) OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=1
8	Q24JK4	8.06e-26	111	353	0.077	0.139	XRCC1_ARATH DNA-repair protein XRCC1 OS=Arabidopsis thaliana OX=3702 GN=XRCC1 PE=1 SV=1
9	Q6ZNB5	4.63e-22	97.8	234	0.098	0.265	XNDC1_HUMAN Protein XNDC1N OS=Homo sapiens OX=9606 GN=XNDC1N PE=2 SV=2
10	E9PLZ0	1.15e-12	67.8	134	0.077	0.366	E9PLZ0_HUMAN XNDC1N-ZNF705EP-ALG1L9P readthrough OS=Homo sapiens OX=9606 GN=XNDC1N PE=4 SV=1
11	E9PJ82	3.94e-08	53.1	88	0.051	0.364	E9PJ82_HUMAN XRCC1 N-terminal domain containing 1, N-terminal like (Fragment) OS=Homo sapiens OX=9606 GN=XNDC1N PE=4 SV=8
12	E9PP57	4.19e-08	53.1	82	0.051	0.390	E9PP57_HUMAN XRCC1 N-terminal domain containing 1, N-terminal like (Fragment) OS=Homo sapiens OX=9606 GN=XNDC1N PE=4 SV=1
13	Q9R244	9.34e-08	57.8	1172	0.038	0.020	TRPC2_MOUSE Short transient receptor potential channel 2 OS=Mus musculus OX=10090 GN=Trpc2 PE=2 SV=2
14	P32372	4.84e-06	52.0	648	0.106	0.103	RAD4_SCHPO S-M checkpoint control protein rad4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rad4 PE=1 SV=2
15	Q95QG8	7.19e-04	45.1	659	0.043	0.041	FCP1_CAEEL RNA polymerase II subunit A C-terminal domain phosphatase OS=Caenorhabditis elegans OX=6239 GN=fcp-1 PE=1 SV=2
16	A0A2R8YD63	8.19e-04	45.1	1517	0.052	0.022	A0A2R8YD63_HUMAN DNA topoisomerase II binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=1
17	Q92547	8.55e-04	45.1	1522	0.052	0.022	TOPB1_HUMAN DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3
18	A3EWL3	0.002	44.3	1105	0.047	0.027	REV1_ARATH DNA repair protein REV1 OS=Arabidopsis thaliana OX=3702 GN=REV1 PE=2 SV=1
19	Q6ZQF0	0.002	43.9	1515	0.049	0.020	TOPB1_MOUSE DNA topoisomerase 2-binding protein 1 OS=Mus musculus OX=10090 GN=Topbp1 PE=1 SV=2
20	Q9ZW89	0.002	43.1	453	0.038	0.053	Q9ZW89_ARATH RING-type E3 ubiquitin transferase BRCA1 OS=Arabidopsis thaliana OX=3702 GN=At1g67180 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00533 BRCT	5.5e-20	82.8	BRCA1 C Terminus (BRCT) domain
2	PF16589 BRCT_2	1.3e-17	75.3	BRCT domain, a BRCA1 C-terminus domain
3	PF16759 LIG3_BRCT	0.031	25.9	DNA ligase 3 BRCT domain
4	PF12738 PTCB-BRCT	3.9e-08	44.5	twin BRCT domain
5	PF01834 XRCC1_N	2.6e-62	220.7	XRCC1 N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262887

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000265421	0.999	DNA polymerase beta
2	9606.ENSP00000323511	0.999	Bifunctional polynucleotide phosphatase/kinase
3	9606.ENSP00000355759	0.999	Poly [ADP-ribose] polymerase 1
4	9606.ENSP00000367787	0.999	DNA ligase 3
5	9606.ENSP00000400806	0.999	Aprataxin
6	9606.ENSP00000216714	0.996	DNA-(apurinic or apyrimidinic site) lyase
7	9606.ENSP00000306561	0.992	N-glycosylase/DNA lyase
8	9606.ENSP00000337353	0.991	Tyrosyl-DNA phosphodiesterase 1
9	9606.ENSP00000347170	0.990	Endonuclease 8-like 1
10	9606.ENSP00000421491	0.988	DNA repair protein XRCC4
11	9606.ENSP00000307004	0.982	Aprataxin and PNK-like factor
12	9606.ENSP00000406046	0.977	DNA polymerase delta catalytic subunit
13	9606.ENSP00000352257	0.969	X-ray repair cross-complementing protein 6
14	9606.ENSP00000305480	0.968	Flap endonuclease 1
15	9606.ENSP00000322570	0.968	DNA polymerase epsilon catalytic subunit A
16	9606.ENSP00000368458	0.968	Proliferating cell nuclear antigen
17	9606.ENSP00000263274	0.966	DNA ligase 1
18	9606.ENSP00000250416	0.964	Poly [ADP-ribose] polymerase 2
19	9606.ENSP00000261427	0.951	Ubiquitin-conjugating enzyme E2 K
20	9606.ENSP00000363017	0.941	Replication protein A 32 kDa subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003676	0.997	nucleic acid binding
GO:0003677	0.994	DNA binding
GO:0019899	0.990	enzyme binding
GO:0003684	0.961	damaged DNA binding
GO:0097367	0.941	carbohydrate derivative binding
GO:0003824	0.731	catalytic activity
GO:0072572	0.692	poly-ADP-D-ribose binding
GO:0032356	0.688	oxidized DNA binding
GO:0140097	0.542	catalytic activity, acting on DNA
GO:0016787	0.302	hydrolase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.999	response to stimulus
GO:0044238	0.999	primary metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0006807	0.998	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0006259	0.993	DNA metabolic process
GO:0006974	0.991	cellular response to DNA damage stimulus
GO:0050789	0.979	regulation of biological process
GO:0050794	0.957	regulation of cellular process
GO:0019222	0.935	regulation of metabolic process
GO:0060255	0.930	regulation of macromolecule metabolic process
GO:0051171	0.926	regulation of nitrogen compound metabolic process
GO:0006281	0.926	DNA repair
GO:0080090	0.925	regulation of primary metabolic process
GO:0031323	0.911	regulation of cellular metabolic process
GO:0048522	0.907	positive regulation of cellular process
GO:0009893	0.903	positive regulation of metabolic process
GO:0019219	0.896	regulation of nucleobase-containing compound metabolic process
GO:0010604	0.832	positive regulation of macromolecule metabolic process
GO:0051052	0.832	regulation of DNA metabolic process
GO:0006302	0.831	double-strand break repair
GO:0051173	0.818	positive regulation of nitrogen compound metabolic process
GO:0031325	0.806	positive regulation of cellular metabolic process
GO:0065009	0.740	regulation of molecular function
GO:0045935	0.737	positive regulation of nucleobase-containing compound metabolic process
GO:0048583	0.679	regulation of response to stimulus
GO:0051054	0.504	positive regulation of DNA metabolic process
GO:0050790	0.502	regulation of catalytic activity
GO:0080134	0.452	regulation of response to stress
GO:2001020	0.405	regulation of response to DNA damage stimulus
GO:0071840	0.399	cellular component organization or biogenesis
GO:0048584	0.396	positive regulation of response to stimulus
GO:0006282	0.385	regulation of DNA repair
GO:0032501	0.371	multicellular organismal process
GO:0016043	0.365	cellular component organization
GO:0006284	0.363	base-excision repair
GO:0048519	0.353	negative regulation of biological process
GO:0006310	0.347	DNA recombination
GO:0051338	0.340	regulation of transferase activity
GO:2001022	0.340	positive regulation of response to DNA damage stimulus
GO:0042221	0.334	response to chemical
GO:0048523	0.325	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.991	nucleoplasm
GO:0043232	0.977	intracellular non-membrane-bounded organelle
GO:0005694	0.829	chromosome
GO:0032991	0.767	protein-containing complex
GO:0005737	0.417	cytoplasm
GO:0090734	0.382	site of DNA damage
GO:0000785	0.372	chromatin
GO:0005730	0.372	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.302	Hydrolases.

[back to server]