StarFunc result for job id P19012

User Input

>input (456 residues)
MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGY
GGGMRVCGFGGGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYL
DKVRALEEANADLEVKIHDWYQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILE
IDNARLAADDFRLKYENELALRQGVEADINGLRRVLDELTLARTDLEMQIEGLNEELAYL
KKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMREQYEAMAEKNRRDVEAWFFSK
TEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSLAETECRYATQ
LQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI
AIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19012	1.000	1.000	1.564E-60	456	1.000	1.000	P19012.pdb.gz	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
2	AFDB:Q61414	0.643	0.648	2.070E-50	452	0.888	0.896	Q61414.pdb.gz	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
3	AFDB:Q6IFV4	0.503	0.521	1.433E-38	438	0.728	0.758	Q6IFV4.pdb.gz	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
4	AFDB:Q6PVZ1	0.709	0.694	5.769E-38	467	0.636	0.621	Q6PVZ1.pdb.gz	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
5	AFDB:A1A4E9	0.506	0.505	2.688E-37	458	0.726	0.723	A1A4E9.pdb.gz	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
6	AFDB:Q6IFV1	0.439	0.416	6.478E-37	485	0.643	0.604	Q6IFV1.pdb.gz	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
7	AFDB:P02533	0.515	0.500	4.686E-36	472	0.660	0.638	P02533.pdb.gz	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
8	AFDB:P08779	0.643	0.623	1.753E-35	473	0.656	0.632	P08779.pdb.gz	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
9	AFDB:Q6IFU8	0.577	0.602	1.580E-34	433	0.616	0.649	Q6IFU8.pdb.gz	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
10	AFDB:Q9Z2K1	0.539	0.526	7.141E-33	469	0.618	0.601	Q9Z2K1.pdb.gz	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
11	PDB:1u6zB	0.039	0.036	1.262	500	0.015	0.014	1u6zB.pdb.gz
12	PDB:1ksgB	0.045	0.151	3.788	128	0.009	0.031	1ksgB.pdb.gz	The complex of Arl2-GTP and PDE delta: from structure to function.
13	PDB:6lthM	0.054	0.081	4.077	259	0.015	0.027	6lthM.pdb.gz	Structure of nucleosome-bound human BAF complex.
14	PDB:4qyzI	0.048	0.085	4.720	256	0.007	0.012	4qyzI.pdb.gz	Structural biology. Crystal structure of a CRISPR RNA-guided surveillance complex bound to a ssDNA target.
15	PDB:4v60A	0.148	0.094	6.328	812	0.070	0.039	4v60A.pdb.gz
16	PDB:2wj8N	0.033	0.039	6.809	378	0.007	0.008	2wj8N.pdb.gz	Crystal Structure of a Nucleocapsid-Like Nucleoprotein-RNA Complex of Respiratory Syncytial Virus
17	PDB:2ygdA	0.042	0.096	6.809	175	0.011	0.029	2ygdA.pdb.gz
18	PDB:5c0wJ	0.041	0.020	7.327	970	0.009	0.004	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
19	PDB:7qi4f	0.033	0.086	7.327	157	0.013	0.038	7qi4f.pdb.gz	Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
20	PDB:1w7cA	0.039	0.025	7.884	737	0.011	0.007	1w7cA.pdb.gz	The 1.23 A Structure of Pichia Pastoris Lysyl Oxidase Reveals a Lysine-Lysine Cross-Link

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1A4E9	0.0	578	458	0.616	0.614	A1A4E9_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
2	K7ERE3	0.0	575	415	0.605	0.665	K7ERE3_HUMAN Keratin 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=1
3	P08730	0.0	570	437	0.693	0.723	K1C13_MOUSE Keratin, type I cytoskeletal 13 OS=Mus musculus OX=10090 GN=Krt13 PE=1 SV=2
4	P13646	0.0	580	458	0.618	0.616	K1C13_HUMAN Keratin, type I cytoskeletal 13 OS=Homo sapiens OX=9606 GN=KRT13 PE=1 SV=4
5	P19012	0.0	915	456	1.000	1.000	K1C15_HUMAN Keratin, type I cytoskeletal 15 OS=Homo sapiens OX=9606 GN=KRT15 PE=1 SV=3
6	Q61414	0.0	659	452	0.849	0.856	K1C15_MOUSE Keratin, type I cytoskeletal 15 OS=Mus musculus OX=10090 GN=Krt15 PE=1 SV=2
7	Q6IFV3	0.0	655	447	0.851	0.868	K1C15_RAT Keratin, type I cytoskeletal 15 OS=Rattus norvegicus OX=10116 GN=Krt15 PE=1 SV=1
8	Q6IFV4	0.0	574	438	0.691	0.719	K1C13_RAT Keratin, type I cytoskeletal 13 OS=Rattus norvegicus OX=10116 GN=Krt13 PE=3 SV=1
9	Q6IFU8	2.18e-178	508	433	0.581	0.612	K1C17_RAT Keratin, type I cytoskeletal 17 OS=Rattus norvegicus OX=10116 GN=Krt17 PE=1 SV=1
10	Q9QWL7	1.94e-177	505	433	0.579	0.610	K1C17_MOUSE Keratin, type I cytoskeletal 17 OS=Mus musculus OX=10090 GN=Krt17 PE=1 SV=3
11	P08779	6.77e-175	500	473	0.539	0.520	K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens OX=9606 GN=KRT16 PE=1 SV=4
12	Q04695	8.56e-175	498	432	0.539	0.569	K1C17_HUMAN Keratin, type I cytoskeletal 17 OS=Homo sapiens OX=9606 GN=KRT17 PE=1 SV=2
13	P02533	1.29e-174	499	472	0.542	0.523	K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens OX=9606 GN=KRT14 PE=1 SV=4
14	P19001	1.47e-174	496	403	0.586	0.663	K1C19_MOUSE Keratin, type I cytoskeletal 19 OS=Mus musculus OX=10090 GN=Krt19 PE=1 SV=1
15	Q6IFV1	4.59e-172	493	485	0.542	0.509	K1C14_RAT Keratin, type I cytoskeletal 14 OS=Rattus norvegicus OX=10116 GN=Krt14 PE=2 SV=1
16	Q61781	3.88e-170	488	484	0.535	0.504	K1C14_MOUSE Keratin, type I cytoskeletal 14 OS=Mus musculus OX=10090 GN=Krt14 PE=1 SV=2
17	Q6PVZ1	2.14e-169	486	467	0.531	0.518	K1C14_CHICK Keratin, type I cytoskeletal 14 OS=Gallus gallus OX=9031 GN=KRT14 PE=2 SV=1
18	Q9Z2K1	1.62e-160	463	469	0.496	0.482	K1C16_MOUSE Keratin, type I cytoskeletal 16 OS=Mus musculus OX=10090 GN=Krt16 PE=1 SV=3
19	Q63279	2.92e-160	460	403	0.555	0.628	K1C19_RAT Keratin, type I cytoskeletal 19 OS=Rattus norvegicus OX=10116 GN=Krt19 PE=1 SV=2
20	P08727	3.52e-157	452	400	0.509	0.580	K1C19_HUMAN Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10186 ATG14	0.18	22.5	Vacuolar sorting 38 and autophagy-related subunit 14
2	PF05791 Bacillus_HBL	4.4	18.6	Bacillus haemolytic enterotoxin (HBL)
3	PF04513 Baculo_PEP_C	4.1e+02	12.4	Baculovirus polyhedron envelope protein, PEP, C terminus
4	PF14362 DUF4407	1.5e+02	13.1	Domain of unknown function (DUF4407)
5	PF15397 DUF4618	19	16.1	Domain of unknown function (DUF4618)
6	PF17282 DUF5347	3.2e+02	12.9	Family of unknown function (DUF5347)
7	PF00038 Filament	3.9e-114	393.1	Intermediate filament protein
8	PF09744 Jnk-SapK_ap_N	3e+02	13.2	JNK_SAPK-associated protein-1
9	PF18265 Nas2_N	3.5e+02	12.5	Nas2 N_terminal domain
10	PF07926 TPR_MLP1_2	7.5	18.0	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000254043

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246635	0.669	Keratin, type I cytoskeletal 13
2	9606.ENSP00000356247	0.619	Leucine-rich repeat-containing G-protein coupled receptor 6
3	9606.ENSP00000369317	0.582	Keratin, type II cytoskeletal 6A
4	9606.ENSP00000273261	0.573	Leucine-rich repeats and immunoglobulin-like domains protein 1
5	9606.ENSP00000007735	0.572	Keratin, type I cuticular Ha3-I
6	9606.ENSP00000310036	0.565	Hematopoietic progenitor cell antigen CD34
7	9606.ENSP00000357731	0.560	Loricrin
8	9606.ENSP00000252242	0.546	Keratin, type II cytoskeletal 5
9	9606.ENSP00000263946	0.546	Plakophilin-1
10	9606.ENSP00000251645	0.545	Keratin, type I cuticular Ha1
11	9606.ENSP00000266719	0.543	Keratocan
12	9606.ENSP00000167586	0.539	Keratin, type I cytoskeletal 14
13	9606.ENSP00000251646	0.536	Keratin, type I cuticular Ha3-II
14	9606.ENSP00000225899	0.535	Keratin, type I cuticular Ha2
15	9606.ENSP00000266674	0.534	Leucine-rich repeat-containing G-protein coupled receptor 5
16	9606.ENSP00000377508	0.532	Junction plakoglobin
17	9606.ENSP00000377570	0.528	Keratin, type I cuticular Ha4
18	9606.ENSP00000420298	0.519	OX-2 membrane glycoprotein
19	9606.ENSP00000329165	0.516	Keratin, type I cuticular Ha6
20	9606.ENSP00000334798	0.516	Keratin, type I cytoskeletal 26

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.988	structural molecule activity
GO:0005200	0.809	structural constituent of cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.988	developmental process
GO:0009987	0.986	cellular process
GO:0048856	0.972	anatomical structure development
GO:0008544	0.904	epidermis development
GO:0065007	0.697	biological regulation
GO:0050789	0.676	regulation of biological process
GO:0050794	0.503	regulation of cellular process
GO:0050896	0.492	response to stimulus
GO:0032501	0.489	multicellular organismal process
GO:0071840	0.478	cellular component organization or biogenesis
GO:0016043	0.443	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005882	0.996	intermediate filament
GO:0005576	0.979	extracellular region
GO:0005829	0.978	cytosol
GO:0043227	0.977	membrane-bounded organelle
GO:0005615	0.885	extracellular space
GO:0045095	0.878	keratin filament
GO:0043231	0.871	intracellular membrane-bounded organelle
GO:0070062	0.847	extracellular exosome
GO:0005634	0.806	nucleus
GO:0016020	0.683	membrane
GO:0005886	0.622	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]