StarFunc result for job id P19013

User Input

>input (520 residues)
MIARQQCVRGGPRGFSCGSAIVGGGKRGAFSSVSMSGGAGRCSSGGFGSRSLYNLRGNKS
ISMSVAGSRQGACFGGAGGFGTGGFGGGFGGSFSGKGGPGFPVCPAGGIQEVTINQSLLT
PLHVEIDPEIQKVRTEEREQIKLLNNKFASFIDKVQFLEQQNKVLETKWNLLQQQTTTTS
SKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAEND
FVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNR
NLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNR
MIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEAALQQAKEELARMLR
EYQELMSVKLALDIEIATYRKLLEGEEYRMSGECQSAVSISVVSGSTSTGGISGGLGSGS
GFGLSSGFGSGSGSGFGFGGSVSGSSSSKIISTTTLNKRR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19013	1.000	1.000	4.502E-65	520	1.000	1.000	P19013.pdb.gz	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
2	AFDB:P07744	0.310	0.308	7.674E-49	525	0.817	0.810	P07744.pdb.gz	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
3	AFDB:P02538	0.291	0.271	6.219E-38	564	0.669	0.617	P02538.pdb.gz	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
4	AFDB:O95678	0.288	0.273	9.078E-38	551	0.656	0.619	O95678.pdb.gz	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
5	AFDB:Q6PVZ5	0.347	0.307	9.078E-38	599	0.669	0.581	Q6PVZ5.pdb.gz	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
6	AFDB:Q8BGZ7	0.344	0.328	1.663E-37	551	0.627	0.592	Q8BGZ7.pdb.gz	K2C75_MOUSE Keratin, type II cytoskeletal 75 OS=Mus musculus OX=10090 GN=Krt75 PE=1 SV=1
7	AFDB:P12035	0.604	0.510	7.001E-37	628	0.700	0.580	P12035.pdb.gz	K2C3_HUMAN Keratin, type II cytoskeletal 3 OS=Homo sapiens OX=9606 GN=KRT3 PE=1 SV=3
8	AFDB:Q9Z331	0.293	0.272	7.551E-37	562	0.656	0.607	Q9Z331.pdb.gz	K2C6B_MOUSE Keratin, type II cytoskeletal 6B OS=Mus musculus OX=10090 GN=Krt6b PE=1 SV=3
9	AFDB:P13647	0.293	0.261	1.022E-36	590	0.685	0.603	P13647.pdb.gz	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
10	AFDB:Q5XKE5	0.409	0.400	1.102E-36	535	0.627	0.609	Q5XKE5.pdb.gz	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
11	PDB:5lj5O	0.102	0.165	4.573	283	0.048	0.088	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:6mdmH	0.107	0.313	6.675	147	0.035	0.122	6mdmH.pdb.gz	Structural principles of SNARE complex recognition by the AAA+ protein NSF.
13	PDB:7mqaNA	0.053	0.078	7.765	295	0.044	0.078	7mqaNA.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:6ip52Q	0.052	0.176	8.376	124	0.031	0.129	6ip52Q.pdb.gz	HCV IRES Captures an Actively Translating 80S Ribosome.
15	PDB:7qooU	0.149	0.328	8.376	186	0.048	0.134	7qooU.pdb.gz	Structure of the human inner kinetochore CCAN complex and its significance for human centromere organization.
16	PDB:7mqaSI	0.110	0.074	9.744	803	0.021	0.014	7mqaSI.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	O95678	619	551	0.600	0.566	K2C75_HUMAN Keratin, type II cytoskeletal 75 OS=Homo sapiens OX=9606 GN=KRT75 PE=1 SV=2
2	P02538	571	564	0.525	0.484	K2C6A_HUMAN Keratin, type II cytoskeletal 6A OS=Homo sapiens OX=9606 GN=KRT6A PE=1 SV=3
3	P04259	575	564	0.602	0.555	K2C6B_HUMAN Keratin, type II cytoskeletal 6B OS=Homo sapiens OX=9606 GN=KRT6B PE=1 SV=5
4	P04264	535	644	0.488	0.394	K2C1_HUMAN Keratin, type II cytoskeletal 1 OS=Homo sapiens OX=9606 GN=KRT1 PE=1 SV=6
5	P07744	720	525	0.742	0.735	K2C4_MOUSE Keratin, type II cytoskeletal 4 OS=Mus musculus OX=10090 GN=Krt4 PE=1 SV=2
6	P13647	583	590	0.615	0.542	K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens OX=9606 GN=KRT5 PE=1 SV=3
7	P19013	1053	520	1.000	1.000	K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens OX=9606 GN=KRT4 PE=1 SV=5
8	P48668	575	564	0.598	0.551	K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3
9	P50446	577	553	0.594	0.559	K2C6A_MOUSE Keratin, type II cytoskeletal 6A OS=Mus musculus OX=10090 GN=Krt6a PE=1 SV=3
10	Q0IIN1	534	578	0.529	0.476	Q0IIN1_HUMAN Keratin 77 OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=1
11	Q14CN4	553	511	0.554	0.564	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
12	Q29426	533	629	0.504	0.417	K2C3_RABIT Keratin, type II cytoskeletal 3 OS=Oryctolagus cuniculus OX=9986 GN=KRT3 PE=2 SV=1
13	Q3SY84	565	523	0.590	0.587	K2C71_HUMAN Keratin, type II cytoskeletal 71 OS=Homo sapiens OX=9606 GN=KRT71 PE=1 SV=3
14	Q3UV17	548	594	0.523	0.458	K22O_MOUSE Keratin, type II cytoskeletal 2 oral OS=Mus musculus OX=10090 GN=Krt76 PE=1 SV=1
15	Q5XKE5	580	535	0.581	0.564	K2C79_HUMAN Keratin, type II cytoskeletal 79 OS=Homo sapiens OX=9606 GN=KRT79 PE=1 SV=2
16	Q6IFZ5	543	581	0.519	0.465	Q6IFZ5_RAT Keratin 76 OS=Rattus norvegicus OX=10116 GN=Krt76 PE=2 SV=1
17	Q6P6Q2	561	576	0.513	0.464	K2C5_RAT Keratin, type II cytoskeletal 5 OS=Rattus norvegicus OX=10116 GN=Krt5 PE=1 SV=1
18	Q6PVZ5	541	599	0.504	0.437	Q6PVZ5_CHICK Type II alpha-keratin IIA OS=Gallus gallus OX=9031 GN=KRT5 PE=2 SV=1
19	Q7RTS7	553	529	0.571	0.561	K2C74_HUMAN Keratin, type II cytoskeletal 74 OS=Homo sapiens OX=9606 GN=KRT74 PE=1 SV=2
20	Q7Z794	529	578	0.537	0.483	K2C1B_HUMAN Keratin, type II cytoskeletal 1b OS=Homo sapiens OX=9606 GN=KRT77 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08614 ATG16	3.2	19.5	Autophagy protein 16 (ATG16)
2	PF18035 Bap31_Bap29_C	3.1e+02	12.8	Bap31/Bap29 cytoplasmic coiled-coil domain
3	PF05667 CCDC22	1.4e+02	12.7	Coiled-coil domain-containing protein 22
4	PF10473 CENP-F_leu_zip	0.66	21.4	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
5	PF07889 DUF1664	40	15.7	Protein of unknown function (DUF1664)
6	PF00038 Filament	3.7e-110	380.0	Intermediate filament protein
7	PF09787 Golgin_A5	5.5e+02	11.4	Golgin subfamily A member 5
8	PF09744 Jnk-SapK_ap_N	20	17.0	JNK_SAPK-associated protein-1
9	PF16208 Keratin_2_head	7.4e-27	105.9	Keratin type II head
10	PF02630 SCO1-SenC	28	16.1	SCO1/SenC
11	PF07926 TPR_MLP1_2	1.7	20.1	TPR/MLP1/MLP2-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000448220

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246635	0.728	Keratin, type I cytoskeletal 13
2	9606.ENSP00000370867	0.689	Protein-glutamine gamma-glutamyltransferase E
3	9606.ENSP00000278282	0.634	Uteroglobin
4	9606.ENSP00000485659	0.634	Mucin-5AC
5	9606.ENSP00000373487	0.619	Keratin, type I cytoskeletal 18
6	9606.ENSP00000330391	0.618	Small proline-rich protein 3
7	9606.ENSP00000264731	0.616	Tumor protein 63
8	9606.ENSP00000323880	0.609	Forkhead box protein J1
9	9606.ENSP00000357731	0.587	Loricrin
10	9606.ENSP00000357753	0.584	Involucrin
11	9606.ENSP00000339435	0.558	Serine racemase
12	9606.ENSP00000251646	0.541	Keratin, type I cuticular Ha3-II
13	9606.ENSP00000271835	0.539	Cornulin
14	9606.ENSP00000478425	0.537	Metallothionein-1A
15	9606.ENSP00000250448	0.534	Hepatocyte nuclear factor 3-alpha
16	9606.ENSP00000252245	0.527	Keratin, type II cytoskeletal 75
17	9606.ENSP00000264012	0.525	Cadherin-3
18	9606.ENSP00000296694	0.523	Secretoglobin family 3A member 2
19	9606.ENSP00000369349	0.523	Keratin, type II cuticular Hb1
20	9606.ENSP00000339251	0.518	Keratinocyte differentiation-associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005198	0.815	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0048856	0.992	anatomical structure development
GO:0071840	0.813	cellular component organization or biogenesis
GO:0065007	0.790	biological regulation
GO:0016043	0.772	cellular component organization
GO:0009888	0.729	tissue development
GO:0050789	0.684	regulation of biological process
GO:0050794	0.669	regulation of cellular process
GO:0007010	0.615	cytoskeleton organization
GO:0050896	0.514	response to stimulus
GO:0032501	0.486	multicellular organismal process
GO:0030154	0.428	cell differentiation
GO:0008544	0.410	epidermis development
GO:0048513	0.356	animal organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0005576	0.997	extracellular region
GO:0005882	0.996	intermediate filament
GO:0005615	0.994	extracellular space
GO:0031982	0.994	vesicle
GO:0045095	0.974	keratin filament
GO:0070062	0.967	extracellular exosome
GO:0005634	0.950	nucleus
GO:0016020	0.908	membrane
GO:0071944	0.711	cell periphery
GO:0005886	0.532	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]