StarFunc result for job id P19105

User Input

>input (171 residues)
MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASL
GKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQED
YLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0G2JSW0	0.597	0.594	1.631E-27	172	0.982	0.977	A0A0G2JSW0.pdb.gz	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
2	AFDB:P40423	0.633	0.624	1.874E-23	174	0.813	0.799	P40423.pdb.gz	SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster OX=7227 GN=sqh PE=1 SV=1
3	AFDB:Q09510	0.706	0.703	1.031E-22	172	0.713	0.709	Q09510.pdb.gz	MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans OX=6239 GN=mlc-4 PE=1 SV=1
4	PDB:7mf3D	0.524	0.552	5.754E-19	158	0.865	0.937	7mf3D.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
5	AFDB:Q62082	0.596	0.523	1.687E-18	202	0.532	0.450	Q62082.pdb.gz	MYL10_MOUSE Myosin regulatory light chain 10 OS=Mus musculus OX=10090 GN=Myl10 PE=2 SV=1
6	AFDB:Q7T2Y1	0.550	0.551	2.864E-18	172	0.544	0.541	Q7T2Y1.pdb.gz
7	AFDB:P04466	0.547	0.552	1.576E-17	169	0.538	0.544	P04466.pdb.gz	MYL11_RAT Myosin regulatory light chain 11 OS=Rattus norvegicus OX=10116 GN=Myl11 PE=1 SV=2
8	AFDB:P08733	0.691	0.707	2.379E-17	166	0.526	0.542	P08733.pdb.gz	MLRV_RAT Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Rattus norvegicus OX=10116 GN=Myl2 PE=1 SV=2
9	AFDB:Q02045	0.575	0.569	3.590E-17	173	0.550	0.543	Q02045.pdb.gz	MYL5_HUMAN Myosin light chain 5 OS=Homo sapiens OX=9606 GN=MYL5 PE=2 SV=1
10	AFDB:A0A060WU79	0.685	0.600	6.463E-17	200	0.480	0.410	A0A060WU79.pdb.gz	A0A060WU79_ONCMY EF-hand domain-containing protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00039796001 PE=4 SV=1
11	AFDB:Q01449	0.510	0.501	1.035E-16	175	0.485	0.474	Q01449.pdb.gz	MLRA_HUMAN Myosin regulatory light chain 2, atrial isoform OS=Homo sapiens OX=9606 GN=MYL7 PE=1 SV=1
12	PDB:7qioP	0.476	0.537	9.707E-12	143	0.491	0.587	7qioP.pdb.gz
13	PDB:5tbyE	0.566	0.597	6.758E-11	160	0.532	0.569	5tbyE.pdb.gz
14	PDB:1i84U	0.496	0.577	1.451E-10	138	0.415	0.514	1i84U.pdb.gz
15	PDB:3wfnB	0.364	0.368	1.819E-9	169	0.357	0.361	3wfnB.pdb.gz
16	PDB:2f2pA	0.360	0.363	3.276E-9	169	0.374	0.379	2f2pA.pdb.gz	Structure of calmodulin bound to a calcineurin Peptide: a new way of making an old binding mode.
17	PDB:1ggzA	0.421	0.489	6.634E-9	144	0.339	0.403	1ggzA.pdb.gz	Crystal structure of human calmodulin-like protein: insights into its functional role.
18	PDB:1osaA	0.377	0.431	6.634E-9	148	0.339	0.392	1osaA.pdb.gz	Structure of the recombinant Paramecium tetraurelia calmodulin at 1.68 A resolution.
19	PDB:5a2hA	0.385	0.441	6.634E-9	147	0.339	0.395	5a2hA.pdb.gz	Crystal Structure of Arabidopsis Thaliana Calmodulin7 and Insight Into its Mode of DNA Binding.
20	PDB:6xyrA	0.369	0.188	9.440E-9	348	0.368	0.181	6xyrA.pdb.gz	Chimeric single alpha-helical domains as rigid fusion protein connections for protein nanotechnology and structural biology.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19105	1.01e-125	352	171	1.000	1.000	ML12A_HUMAN Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2
2	Q53HL1	4.62e-125	350	171	0.994	0.994	Q53HL1_HUMAN Myosin regulatory light chain MRCL3 variant (Fragment) OS=Homo sapiens OX=9606 PE=2 SV=1
3	Q5E9E2	2.00e-123	346	172	0.994	0.988	MYL9_BOVIN Myosin regulatory light polypeptide 9 OS=Bos taurus OX=9913 GN=MYL9 PE=2 SV=3
4	A0A8I6AWG5	2.17e-122	345	208	0.982	0.808	A0A8I6AWG5_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
5	A0A8I5ZNJ5	3.15e-122	343	178	0.982	0.944	A0A8I5ZNJ5_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
6	Q6ZWQ9	3.51e-122	343	172	0.982	0.977	Q6ZWQ9_MOUSE Myosin, light chain 12A, regulatory, non-sarcomeric OS=Mus musculus OX=10090 GN=Myl12a PE=1 SV=1
7	A0A0G2JSW0	4.51e-122	343	172	0.982	0.977	A0A0G2JSW0_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12b PE=4 SV=2
8	O14950	5.20e-122	342	172	0.982	0.977	ML12B_HUMAN Myosin regulatory light chain 12B OS=Homo sapiens OX=9606 GN=MYL12B PE=1 SV=2
9	Q3THE2	5.20e-122	342	172	0.982	0.977	ML12B_MOUSE Myosin regulatory light chain 12B OS=Mus musculus OX=10090 GN=Myl12b PE=1 SV=2
10	P18666	1.09e-120	339	172	0.977	0.971	ML12B_RAT Myosin regulatory light chain 12B OS=Rattus norvegicus OX=10116 GN=Myl12b PE=1 SV=3
11	A0A8L2UJI1	4.77e-118	332	169	0.971	0.982	A0A8L2UJI1_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
12	A0A8I5ZXA1	1.17e-116	330	208	0.942	0.774	A0A8I5ZXA1_RAT Myosin light chain 12A OS=Rattus norvegicus OX=10116 GN=Myl12a PE=4 SV=1
13	Q9CQ19	4.59e-111	315	172	0.877	0.872	MYL9_MOUSE Myosin regulatory light polypeptide 9 OS=Mus musculus OX=10090 GN=Myl9 PE=1 SV=3
14	P24844	1.81e-110	313	172	0.871	0.866	MYL9_HUMAN Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9 PE=1 SV=4
15	P02612	4.35e-110	312	172	0.865	0.860	MLRM_CHICK Myosin regulatory light chain 2, smooth muscle major isoform OS=Gallus gallus OX=9031 PE=1 SV=2
16	P40423	2.09e-100	288	174	0.819	0.805	SQH_DROME Myosin regulatory light chain sqh OS=Drosophila melanogaster OX=7227 GN=sqh PE=1 SV=1
17	Q09510	2.64e-89	260	172	0.719	0.715	MLRH_CAEEL Myosin regulatory light chain OS=Caenorhabditis elegans OX=6239 GN=mlc-4 PE=1 SV=1
18	D3YV37	2.31e-71	212	107	0.608	0.972	D3YV37_MOUSE Myosin, light chain 12A, regulatory, non-sarcomeric (Fragment) OS=Mus musculus OX=10090 GN=Myl12a PE=1 SV=1
19	Q801M3	8.83e-63	192	172	0.550	0.547	Q801M3_DANRE Myosin light chain 2 Mlc2a OS=Danio rerio OX=7955 GN=cmlc2 PE=1 SV=1
20	P10916	1.22e-62	192	166	0.538	0.554	MLRV_HUMAN Myosin regulatory light chain 2, ventricular/cardiac muscle isoform OS=Homo sapiens OX=9606 GN=MYL2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13817 DDE_Tnp_IS66_C	3.6e+02	12.8	IS66 C-terminal element
2	PF10025 DUF2267	1.2e+02	14.5	Uncharacterized conserved protein (DUF2267)
3	PF10869 DUF2666	1.6e+02	13.9	Protein of unknown function (DUF2666)
4	PF12552 DUF3741	1.4e+02	13.8	Protein of unknown function (DUF3741)
5	PF00036 EF-hand_1	1.1e-10	51.3	EF hand
6	PF08976 EF-hand_11	0.0056	28.9	EF-hand domain
7	PF13202 EF-hand_5	0.034	24.8	EF hand
8	PF13405 EF-hand_6	5.5e-08	43.0	EF-hand domain
9	PF13499 EF-hand_7	1.1e-10	53.1	EF-hand domain pair
10	PF13833 EF-hand_8	0.00016	32.7	EF-hand domain pair
11	PF14658 EF-hand_9	1.2	20.9	EF-hand domain
12	PF16905 GPHH	52	15.2	Voltage-dependent L-type calcium channel, IQ-associated
13	PF10591 SPARC_Ca_bdg	2.4e+02	13.5	Secreted protein acidic and rich in cysteine Ca binding region
14	PF13623 SurA_N_2	1e+02	14.2	SurA N-terminal domain
15	PF03672 UPF0154	24	16.3	Uncharacterised protein family (UPF0154)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000010136

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000013132	0.971	Uncharacterized protein
2	9601.ENSPPYP00000015066	0.956	Myosin light chain kinase
3	9601.ENSPPYP00000010161	0.942	Rho-associated, coiled-coil containing protein kinase 1
4	9601.ENSPPYP00000014119	0.942	Rho-associated protein kinase
5	9601.ENSPPYP00000013994	0.927	Serine/threonine-protein phosphatase PP1-beta catalytic subunit
6	9601.ENSPPYP00000008953	0.921	Myosin, heavy chain 10, non-muscle
7	9601.ENSPPYP00000003472	0.891	Protein phosphatase 1, catalytic subunit, alpha isozyme
8	9601.ENSPPYP00000005654	0.890	Protein phosphatase 1, catalytic subunit, gamma isozyme
9	9601.ENSPPYP00000005656	0.890	Myosin, light chain 2, regulatory, cardiac, slow
10	9601.ENSPPYP00000008714	0.882	Kinase that phosphorylates MYL2 in vitro. Promotes sarcomere formation in cardiomyocytes and increases cardiomyocyte contractility (By similarity)
11	9601.ENSPPYP00000014678	0.877	Myosin, light chain 1, alkali
12	9601.ENSPPYP00000008063	0.852	Myosin, heavy chain 11, smooth muscle
13	9601.ENSPPYP00000018087	0.848	Myosin light chain kinase family, member 4
14	9601.ENSPPYP00000009805	0.820	Actin, gamma 1
15	9601.ENSPPYP00000019427	0.820	Actin, cytoplasmic 1
16	9601.ENSPPYP00000005293	0.803	Regulatory light chain of myosin. Does not bind calcium (By similarity)
17	9601.ENSPPYP00000010135	0.801	Myosin, light chain 12B, regulatory
18	9601.ENSPPYP00000005720	0.786	Plays a role in cytokinesis. Displays serine/threonine protein kinase activity
19	9601.ENSPPYP00000011505	0.761	Myosin, heavy chain 14, non-muscle
20	9601.ENSPPYP00000005469	0.758	Protein phosphatase 1, regulatory subunit 12A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008092	0.960	cytoskeletal protein binding
GO:0017022	0.547	myosin binding
GO:0032036	0.368	myosin heavy chain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.993	biological regulation
GO:0009987	0.993	cellular process
GO:0050789	0.983	regulation of biological process
GO:0032501	0.963	multicellular organismal process
GO:0022604	0.943	regulation of cell morphogenesis
GO:0050896	0.908	response to stimulus
GO:0048856	0.898	anatomical structure development
GO:0071840	0.891	cellular component organization or biogenesis
GO:0016043	0.883	cellular component organization
GO:0030029	0.869	actin filament-based process
GO:0007155	0.864	cell adhesion
GO:0008360	0.823	regulation of cell shape
GO:0007596	0.822	blood coagulation
GO:0034109	0.820	homotypic cell-cell adhesion
GO:0050794	0.815	regulation of cellular process
GO:0070527	0.805	platelet aggregation
GO:0031032	0.794	actomyosin structure organization
GO:0009653	0.696	anatomical structure morphogenesis
GO:0051239	0.651	regulation of multicellular organismal process
GO:0044085	0.636	cellular component biogenesis
GO:0051179	0.401	localization
GO:0007275	0.381	multicellular organism development
GO:0048518	0.352	positive regulation of biological process
GO:0051716	0.305	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0005737	0.998	cytoplasm
GO:0032991	0.996	protein-containing complex
GO:0005856	0.981	cytoskeleton
GO:0005829	0.973	cytosol
GO:0015629	0.973	actin cytoskeleton
GO:0099080	0.951	supramolecular complex
GO:0016459	0.941	myosin complex
GO:0016460	0.902	myosin II complex
GO:0043227	0.898	membrane-bounded organelle
GO:0099512	0.879	supramolecular fiber
GO:0005576	0.842	extracellular region
GO:0043292	0.839	contractile fiber
GO:0016020	0.798	membrane
GO:0031982	0.732	vesicle
GO:0043230	0.707	extracellular organelle
GO:0043231	0.684	intracellular membrane-bounded organelle
GO:0005615	0.683	extracellular space
GO:1903561	0.681	extracellular vesicle
GO:0030016	0.639	myofibril
GO:0070062	0.637	extracellular exosome
GO:0042641	0.462	actomyosin
GO:0030017	0.360	sarcomere
GO:0071944	0.325	cell periphery
GO:0001725	0.305	stress fiber

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]