StarFunc result for job id P19113

User Input

>input (662 residues)
MMEPEEYRERGREMVDYICQYLSTVRERRVTPDVQPGYLRAQLPESAPEDPDSWDSIFGD
IERIIMPGVVHWQSPHMHAYYPALTSWPSLLGDMLADAINCLGFTWASSPACTELEMNVM
DWLAKMLGLPEHFLHHHPSSQGGGVLQSTVSESTLIALLAARKNKILEMKTSEPDADESC
LNARLVAYASDQAHSSVEKAGLISLVKMKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVF
VCATLGTTGVCAFDCLSELGPICAREGLWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFT
FNPSKWMMVHFDCTGFWVKDKYKLQQTFSVNPIYLRHANSGVATDFMHWQIPLSRRFRSV
KLWFVIRSFGVKNLQAHVRHGTEMAKYFESLVRNDPSFEIPAKRHLGLVVFRLKGPNCLT
ENVLKEIAKAGRLFLIPATIQDKLIIRFTVTSQFTTRDDILRDWNLIRDAATLILSQHCT
SQPSPRVGNLISQIRGARAWACGTSLQSVSGAGDDPVQARKIIKQPQRVGAGPMKRENGL
HLETLLDPVDDCFSEEAPDATKHKLSSFLFSYLSVQTKKKTVRSLSCNSVPVSAQKPLPT
EASVKNGGSSRVRIFSRFPEDMMMLKKSAFKKLIKFYSVPSFPECSSQCGLQLPCCPLQA
MV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19113	1.000	1.000	0.000	662	1.000	1.000	P19113.pdb.gz	DCHS_HUMAN Histidine decarboxylase OS=Homo sapiens OX=9606 GN=HDC PE=1 SV=2
2	AFDB:P23738	0.772	0.772	4.951E-104	662	0.866	0.866	P23738.pdb.gz	DCHS_MOUSE Histidine decarboxylase OS=Mus musculus OX=10090 GN=Hdc PE=1 SV=2
3	AFDB:P16453	0.774	0.781	2.448E-103	656	0.855	0.863	P16453.pdb.gz	DCHS_RAT Histidine decarboxylase OS=Rattus norvegicus OX=10116 GN=Hdc PE=2 SV=2
4	AFDB:A0A068Q816	0.738	0.736	1.058E-96	664	0.767	0.765	A0A068Q816.pdb.gz	A0A068Q816_CHICK Histidine decarboxylase OS=Gallus gallus OX=9031 GN=HDC PE=2 SV=1
5	AFDB:F8W5Y8	0.701	0.780	1.733E-76	594	0.533	0.594	F8W5Y8.pdb.gz
6	AFDB:Q05733	0.712	0.557	9.508E-74	847	0.491	0.384	Q05733.pdb.gz	DCHS_DROME Histidine decarboxylase OS=Drosophila melanogaster OX=7227 GN=Hdc PE=1 SV=2
7	AFDB:Q7SZR0	0.717	0.987	1.662E-68	480	0.384	0.529	Q7SZR0.pdb.gz	Q7SZR0_DANRE Aromatic-L-amino-acid decarboxylase OS=Danio rerio OX=7955 GN=wu:fa56d05 PE=1 SV=1
8	AFDB:P20711	0.717	0.987	8.492E-68	480	0.373	0.515	P20711.pdb.gz	DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens OX=9606 GN=DDC PE=1 SV=2
9	AFDB:A1Z6N4	0.725	0.753	2.260E-67	637	0.412	0.429	A1Z6N4.pdb.gz	A1Z6N4_DROME MIP05841p OS=Drosophila melanogaster OX=7227 GN=Tdc2 PE=2 SV=1
10	AFDB:O88533	0.716	0.986	4.340E-67	480	0.384	0.529	O88533.pdb.gz	DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus OX=10090 GN=Ddc PE=1 SV=1
11	PDB:3rchA	0.651	0.958	1.482E-57	446	0.347	0.516	3rchA.pdb.gz	Open conformation of human DOPA decarboxylase reveals the mechanism of PLP addition to Group II decarboxylases.
12	PDB:6jrlA	0.691	0.981	6.793E-57	465	0.322	0.458	6jrlA.pdb.gz
13	PDB:3k40A	0.655	0.960	2.164E-54	448	0.344	0.509	3k40A.pdb.gz
14	PDB:6eeiB	0.674	0.943	4.078E-53	471	0.298	0.418	6eeiB.pdb.gz	Structural basis for divergent and convergent evolution of catalytic machineries in plant aromatic amino acid decarboxylase proteins.
15	PDB:6khnA	0.686	0.922	2.007E-50	490	0.263	0.355	6khnA.pdb.gz	Crystal structure ofOryza sativaTDC reveals the substrate specificity for TDC-mediated melatonin biosynthesis.
16	PDB:6zekC	0.603	0.820	2.792E-30	478	0.150	0.207	6zekC.pdb.gz	Structure and substrate specificity determinants of the taurine biosynthetic enzyme cysteine sulphinic acid decarboxylase.
17	PDB:3hbxA	0.546	0.800	1.554E-22	437	0.122	0.185	3hbxA.pdb.gz
18	PDB:5eudA	0.546	0.776	1.829E-22	454	0.113	0.165	5eudA.pdb.gz	Creation of a S1P Lyase bacterial surrogate for structure-based drug design.
19	PDB:3f9tA	0.517	0.842	4.136E-22	394	0.103	0.173	3f9tA.pdb.gz	Crystal structure of L-tyrosine decarboxylase MfnA (EC 4.1.1.25) (NP_247014.1) from METHANOCOCCUS JANNASCHII at 2.11 A resolution
20	PDB:5hsjA	0.509	0.552	1.342E-20	606	0.145	0.158	5hsjA.pdb.gz	Crystal structure of tyrosine decarboxylase and identification of key residues involved in conformational swing and substrate binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A068Q816	0.0	1046	664	0.769	0.767	A0A068Q816_CHICK Histidine decarboxylase OS=Gallus gallus OX=9031 GN=HDC PE=2 SV=1
2	A1Z6N4	0.0	549	637	0.381	0.396	A1Z6N4_DROME MIP05841p OS=Drosophila melanogaster OX=7227 GN=Tdc2 PE=2 SV=1
3	A7KBS5	0.0	714	594	0.550	0.613	A7KBS5_DANRE Histidine decarboxylase OS=Danio rerio OX=7955 GN=hdc PE=2 SV=1
4	O88533	0.0	540	480	0.385	0.531	DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus OX=10090 GN=Ddc PE=1 SV=1
5	P14173	0.0	563	480	0.390	0.537	DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus OX=10116 GN=Ddc PE=1 SV=1
6	P16453	0.0	1170	656	0.858	0.866	DCHS_RAT Histidine decarboxylase OS=Rattus norvegicus OX=10116 GN=Hdc PE=2 SV=2
7	P19113	0.0	1380	662	1.000	1.000	DCHS_HUMAN Histidine decarboxylase OS=Homo sapiens OX=9606 GN=HDC PE=1 SV=2
8	P20711	0.0	552	480	0.375	0.517	DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens OX=9606 GN=DDC PE=1 SV=2
9	P23738	0.0	1183	662	0.867	0.867	DCHS_MOUSE Histidine decarboxylase OS=Mus musculus OX=10090 GN=Hdc PE=1 SV=2
10	Q05733	0.0	656	847	0.444	0.347	DCHS_DROME Histidine decarboxylase OS=Drosophila melanogaster OX=7227 GN=Hdc PE=1 SV=2
11	Q7SZR0	0.0	542	480	0.385	0.531	Q7SZR0_DANRE Aromatic-L-amino-acid decarboxylase OS=Danio rerio OX=7955 GN=wu:fa56d05 PE=1 SV=1
12	P05031	5.76e-177	515	510	0.366	0.475	DDC_DROME Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster OX=7227 GN=Ddc PE=1 SV=4
13	Q95ZS2	2.88e-176	520	705	0.346	0.325	TDC1_CAEEL Tyrosine decarboxylase OS=Caenorhabditis elegans OX=6239 GN=tdc-1 PE=2 SV=1
14	P18486	3.82e-160	472	510	0.340	0.441	DHAPP_DROME 3,4-dihydroxyphenylacetaldehyde synthase OS=Drosophila melanogaster OX=7227 GN=amd PE=1 SV=2
15	Q8MZ32	7.97e-157	466	587	0.334	0.376	Q8MZ32_DROME RE04135p OS=Drosophila melanogaster OX=7227 GN=Tdc1 PE=2 SV=1
16	A1Z6N2	1.41e-156	466	587	0.334	0.376	A1Z6N2_DROME FI02861p OS=Drosophila melanogaster OX=7227 GN=Tdc1 PE=2 SV=1
17	Q16S21	1.58e-156	463	521	0.322	0.409	DHPAA_AEDAE 3,4-dihydroxyphenylacetaldehyde synthase OS=Aedes aegypti OX=7159 GN=AAEL010734 PE=1 SV=1
18	Q7XHL3	3.68e-138	415	497	0.325	0.433	TDC2_ORYSJ Tryptophan decarboxylase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=TDC2 PE=1 SV=1
19	Q8RY79	4.50e-134	404	490	0.304	0.410	PAAS_ARATH Phenylacetaldehyde synthase OS=Arabidopsis thaliana OX=3702 GN=ELI5 PE=1 SV=1
20	H2KYG4	2.52e-131	398	514	0.301	0.387	H2KYG4_CAEEL Aromatic-L-amino-acid decarboxylase OS=Caenorhabditis elegans OX=6239 GN=bas-1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00155 Aminotran_1_2	36	15.0	Aminotransferase class I and II
2	PF01212 Beta_elim_lyase	13	16.6	Beta-eliminating lyase
3	PF00282 Pyridoxal_deC	1.2e-172	585.4	Pyridoxal-dependent decarboxylase conserved domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000267845

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280097	0.980	Histamine N-methyltransferase
2	9606.ENSP00000411613	0.965	Amiloride-sensitive amine oxidase [copper-containing]
3	9606.ENSP00000325548	0.930	Cytosolic non-specific dipeptidase
4	9606.ENSP00000261208	0.917	Histidine ammonia-lyase
5	9606.ENSP00000351682	0.914	Carnosine dipeptidase 1
6	9606.ENSP00000389009	0.902	Carnosine synthase 1
7	9606.ENSP00000380247	0.825	Histamine H1 receptor
8	9606.ENSP00000296046	0.818	M14 carboxypeptidases
9	9606.ENSP00000331358	0.801	Gastrin
10	9606.ENSP00000366506	0.797	Histamine H2 receptor
11	9606.ENSP00000342560	0.774	Histamine H3 receptor
12	9606.ENSP00000256906	0.763	Histamine H4 receptor
13	9606.ENSP00000376776	0.706	Dopamine beta-hydroxylase
14	9606.ENSP00000298472	0.702	Synaptic vesicular amine transporter
15	9606.ENSP00000359521	0.652	SLIT and NTRK-like protein 2
16	9606.ENSP00000347719	0.649	Tubulin-specific chaperone D
17	9606.ENSP00000477548	0.648	Orexin receptor type 2
18	9606.ENSP00000370571	0.647	Tyrosine 3-monooxygenase
19	9606.ENSP00000307549	0.630	Neuronal pentraxin-1
20	9606.ENSP00000384387	0.623	Orexin receptor type 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016831	1.000	carboxy-lyase activity
GO:0005488	0.989	binding
GO:0005515	0.978	protein binding
GO:0004398	0.818	histidine decarboxylase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0071704	0.995	organic substance metabolic process
GO:0006547	0.990	histidine metabolic process
GO:0097164	0.983	ammonium ion metabolic process
GO:0009308	0.970	amine metabolic process
GO:0046483	0.964	heterocycle metabolic process
GO:0006725	0.955	cellular aromatic compound metabolic process
GO:0034641	0.955	cellular nitrogen compound metabolic process
GO:0006576	0.946	biogenic amine metabolic process
GO:1901360	0.945	organic cyclic compound metabolic process
GO:0009058	0.753	biosynthetic process
GO:1901566	0.709	organonitrogen compound biosynthetic process
GO:1901565	0.708	organonitrogen compound catabolic process
GO:0044249	0.697	cellular biosynthetic process
GO:0009063	0.681	amino acid catabolic process
GO:0042401	0.589	biogenic amine biosynthetic process
GO:0019438	0.453	aromatic compound biosynthetic process
GO:1901362	0.430	organic cyclic compound biosynthetic process
GO:0018130	0.412	heterocycle biosynthetic process
GO:0050896	0.371	response to stimulus
GO:0006796	0.338	phosphate-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043229	0.537	intracellular organelle
GO:0043227	0.508	membrane-bounded organelle
GO:0016020	0.464	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.1.1.-	1.000	Carboxy-lyases.
RHEA:20840	0.818	H(+) + L-histidine = CO2 + histamine
EC:4.1.1.22	0.818	histidine decarboxylase.

[back to server]