StarFunc result for job id P19174

User Input

>input (1290 residues)
MAGAASPCANGCGPGAPSDAEVLHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIKGLTWLMEDTLQAPTPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRSGDITYGQFAQLYRSLMYSAQKTMDLPFLEASTLRA
GERPELCRVSLPEFQQFLLDYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSVWNSQLDAVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVEISADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSMM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEVSS
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFIKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVNPVALEPEREHLDENSPLGDLLRGVLDVPACQIAIRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKIMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFMTGRHCGYVLQPSTMRDEAFDPFDKS
SLRGLEPCAISIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSTKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEDL
ELASLLIKIDIFPAKENGDLSPFSGTSLRERGSDASGQLFHGRAREGSFESRYQQPFEDF
RISQEHLADHFDSRERRAPRRTRVNGDNRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QLX2	0.704	0.888	0.000	1020	0.597	0.755	F1QLX2.pdb.gz
2	AFDB:P16885	0.813	0.829	0.000	1265	0.488	0.497	P16885.pdb.gz	PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4
3	AFDB:Q22070	0.563	0.540	0.000	1350	0.345	0.330	Q22070.pdb.gz	PLCG_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma plc-3 OS=Caenorhabditis elegans OX=6239 GN=plc-3 PE=2 SV=2
4	AFDB:Q62077	0.952	0.943	0.000	1302	0.959	0.950	Q62077.pdb.gz	PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus OX=10090 GN=Plcg1 PE=1 SV=2
5	AFDB:Q9VXH3	0.559	0.582	0.000	1236	0.405	0.422	Q9VXH3.pdb.gz	Q9VXH3_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Drosophila melanogaster OX=7227 GN=sl PE=1 SV=3
6	AFDB:O75038	0.509	0.466	2.391E-64	1416	0.226	0.206	O75038.pdb.gz	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
7	AFDB:A2AP18	0.501	0.434	6.869E-64	1501	0.230	0.198	A2AP18.pdb.gz	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
8	AFDB:Q4KWH8	0.503	0.387	2.950E-63	1693	0.226	0.172	Q4KWH8.pdb.gz	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
9	AFDB:Q4KWH5	0.506	0.392	8.914E-63	1682	0.225	0.172	Q4KWH5.pdb.gz	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
10	AFDB:F1Q5G9	0.484	0.794	3.528E-60	761	0.205	0.348	F1Q5G9.pdb.gz	F1Q5G9_DANRE Phosphoinositide phospholipase C OS=Danio rerio OX=7955 GN=plcd4a PE=4 SV=1
11	PDB:4gnkB	0.478	0.776	1.012E-41	769	0.173	0.290	4gnkB.pdb.gz	Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
12	PDB:4gwfA	0.130	0.304	9.826E-13	497	0.069	0.179	4gwfA.pdb.gz
13	PDB:5xzrA	0.131	0.293	4.221E-12	519	0.072	0.179	5xzrA.pdb.gz	Allosteric Inhibitors of SHP2 with Therapeutic Potential for Cancer Treatment.
14	PDB:3ps5A	0.082	0.184	6.697E-11	529	0.050	0.121	3ps5A.pdb.gz	Crystal structure of human protein tyrosine phosphatase SHP-1 in the open conformation.
15	PDB:4k2rA	0.080	0.170	1.164E-10	551	0.044	0.103	4k2rA.pdb.gz	Structural Basis for Activation of ZAP-70 by Phosphorylation of the SH2-Kinase Linker.
16	PDB:4fl2A	0.102	0.198	1.655E-10	555	0.053	0.123	4fl2A.pdb.gz	Structural and biophysical characterization of the syk activation switch.
17	PDB:1griA	0.075	0.390	2.353E-10	211	0.040	0.242	1griA.pdb.gz
18	PDB:2lqnA	0.069	0.264	3.241E-8	303	0.055	0.234	2lqnA.pdb.gz
19	PDB:3qwyA	0.070	0.427	5.357E-8	170	0.026	0.200	3qwyA.pdb.gz
20	PDB:1cjyA	0.087	0.172	7.688E-7	633	0.021	0.043	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1SDV6	0.0	2637	1291	0.977	0.976	F1SDV6_PIG 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Sus scrofa OX=9823 GN=PLCG1 PE=1 SV=5
2	P08487	0.0	2629	1291	0.971	0.970	PLCG1_BOVIN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Bos taurus OX=9913 GN=PLCG1 PE=1 SV=1
3	P10686	0.0	2626	1290	0.969	0.969	PLCG1_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Rattus norvegicus OX=10116 GN=Plcg1 PE=1 SV=1
4	P16885	0.0	1251	1265	0.495	0.504	PLCG2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Homo sapiens OX=9606 GN=PLCG2 PE=1 SV=4
5	P19174	0.0	2699	1290	1.000	1.000	PLCG1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1
6	P24135	0.0	1262	1265	0.498	0.508	PLCG2_RAT 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Rattus norvegicus OX=10116 GN=Plcg2 PE=1 SV=1
7	Q22070	0.0	672	1350	0.336	0.321	PLCG_CAEEL 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma plc-3 OS=Caenorhabditis elegans OX=6239 GN=plc-3 PE=2 SV=2
8	Q62077	0.0	2600	1302	0.959	0.950	PLCG1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Mus musculus OX=10090 GN=Plcg1 PE=1 SV=2
9	Q804J6	0.0	2048	1312	0.764	0.751	Q804J6_DANRE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Danio rerio OX=7955 GN=fj46f04 PE=1 SV=1
10	Q8CIH5	0.0	1265	1265	0.500	0.510	PLCG2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-2 OS=Mus musculus OX=10090 GN=Plcg2 PE=1 SV=1
11	Q9VXH3	0.0	919	1236	0.404	0.422	Q9VXH3_DROME 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma OS=Drosophila melanogaster OX=7227 GN=sl PE=1 SV=3
12	A2AP18	6.34e-66	248	1501	0.117	0.101	PLCH2_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Mus musculus OX=10090 GN=Plch2 PE=1 SV=2
13	O75038	6.86e-66	248	1416	0.119	0.109	PLCH2_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-2 OS=Homo sapiens OX=9606 GN=PLCH2 PE=1 SV=3
14	A0A2U3TZV8	3.45e-63	239	1685	0.133	0.101	A0A2U3TZV8_HUMAN Phosphoinositide phospholipase C OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
15	Q8N3E9	1.16e-62	232	789	0.112	0.184	PLCD3_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3
16	Q8K2J0	2.18e-62	231	785	0.112	0.183	PLCD3_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Mus musculus OX=10090 GN=Plcd3 PE=1 SV=2
17	Q4KWH8	3.29e-62	236	1693	0.131	0.100	PLCH1_HUMAN 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Homo sapiens OX=9606 GN=PLCH1 PE=1 SV=1
18	Q4KWH5	8.97e-62	235	1682	0.133	0.102	PLCH1_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase eta-1 OS=Mus musculus OX=10090 GN=Plch1 PE=2 SV=1
19	A0A8I6AGE0	2.46e-61	227	744	0.110	0.191	A0A8I6AGE0_RAT Phosphoinositide phospholipase C OS=Rattus norvegicus OX=10116 GN=Plcd3 PE=4 SV=1
20	Q8K3R3	8.58e-61	226	807	0.112	0.180	PLCD4_MOUSE 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-4 OS=Mus musculus OX=10090 GN=Plcd4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	6.2e-12	57.1	C2 domain
2	PF03009 GDPD	0.81	21.0	Glycerophosphoryl diester phosphodiesterase family
3	PF00169 PH	1.5e-10	52.9	PH domain
4	PF16457 PH_12	0.41	22.6	Pleckstrin homology domain
5	PF20399 PH_20	1.8e+02	13.6	PH domain
6	PF15410 PH_9	2e+02	13.6	Pleckstrin homology domain
7	PF00388 PI-PLC-X	1.3e-61	217.9	Phosphatidylinositol-specific phospholipase C, X domain
8	PF00387 PI-PLC-Y	3e-34	129.2	Phosphatidylinositol-specific phospholipase C, Y domain
9	PF00017 SH2	2.3e-44	160.7	SH2 domain
10	PF00018 SH3_1	2.1e-10	51.4	SH3 domain
11	PF07653 SH3_2	0.007	27.5	Variant SH3 domain
12	PF14604 SH3_9	0.0004	31.6	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000244007

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261799	0.999	Platelet-derived growth factor receptor beta
2	9606.ENSP00000264033	0.999	E3 ubiquitin-protein ligase CBL
3	9606.ENSP00000275493	0.999	Epidermal growth factor receptor
4	9606.ENSP00000378845	0.999	Linker for activation of T cells
5	9606.ENSP00000393312	0.999	Fibroblast growth factor receptor 1
6	9606.ENSP00000339186	0.998	GRB2-related adapter protein 2
7	9606.ENSP00000410294	0.998	Fibroblast growth factor receptor 2
8	9606.ENSP00000431418	0.998	High affinity nerve growth factor receptor
9	9606.ENSP00000376345	0.997	Growth factor receptor-bound protein 2
10	9606.ENSP00000277120	0.996	BDNF/NT-3 growth factors receptor
11	9606.ENSP00000364907	0.996	Tyrosine-protein kinase SYK
12	9606.ENSP00000046794	0.993	Lymphocyte cytosolic protein 2
13	9606.ENSP00000368966	0.991	Short transient receptor potential channel 3
14	9606.ENSP00000263923	0.989	Vascular endothelial growth factor receptor 2
15	9606.ENSP00000269571	0.989	Receptor tyrosine-protein kinase erbB-2
16	9606.ENSP00000341189	0.988	Focal adhesion kinase 1
17	9606.ENSP00000282397	0.987	Vascular endothelial growth factor receptor 1
18	9606.ENSP00000420494	0.987	Linker for activation of T-cells family member 2
19	9606.ENSP00000262995	0.986	GRB2-associated-binding protein 1
20	9606.ENSP00000337825	0.984	Tyrosine-protein kinase Lck

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004435	0.997	phosphatidylinositol phospholipase C activity
GO:0005102	0.985	signaling receptor binding
GO:0019899	0.965	enzyme binding
GO:0019901	0.957	protein kinase binding
GO:1990782	0.949	protein tyrosine kinase binding
GO:0030971	0.797	receptor tyrosine kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.995	response to stimulus
GO:0050794	0.995	regulation of cellular process
GO:0023052	0.993	signaling
GO:0051716	0.985	cellular response to stimulus
GO:0007165	0.983	signal transduction
GO:0048518	0.982	positive regulation of biological process
GO:0040012	0.981	regulation of locomotion
GO:0030334	0.956	regulation of cell migration
GO:0007166	0.950	cell surface receptor signaling pathway
GO:0002764	0.946	immune response-regulating signaling pathway
GO:0071363	0.940	cellular response to growth factor stimulus
GO:0002429	0.938	immune response-activating cell surface receptor signaling pathway
GO:0051239	0.933	regulation of multicellular organismal process
GO:0032501	0.924	multicellular organismal process
GO:0007167	0.919	enzyme-linked receptor protein signaling pathway
GO:0007169	0.898	transmembrane receptor protein tyrosine kinase signaling pathway
GO:0050851	0.893	antigen receptor-mediated signaling pathway
GO:0032502	0.865	developmental process
GO:0048856	0.854	anatomical structure development
GO:0010959	0.854	regulation of metal ion transport
GO:0051924	0.830	regulation of calcium ion transport
GO:0048522	0.802	positive regulation of cellular process
GO:0035924	0.775	cellular response to vascular endothelial growth factor stimulus
GO:0042221	0.758	response to chemical
GO:0007275	0.752	multicellular organism development
GO:0008152	0.740	metabolic process
GO:0023051	0.702	regulation of signaling
GO:0010646	0.702	regulation of cell communication
GO:2000026	0.685	regulation of multicellular organismal development
GO:0071704	0.678	organic substance metabolic process
GO:0044238	0.654	primary metabolic process
GO:0050852	0.617	T cell receptor signaling pathway
GO:0038127	0.609	ERBB signaling pathway
GO:0044237	0.602	cellular metabolic process
GO:0040017	0.581	positive regulation of locomotion
GO:0019222	0.580	regulation of metabolic process
GO:0034762	0.580	regulation of transmembrane transport
GO:0009966	0.477	regulation of signal transduction
GO:0048519	0.458	negative regulation of biological process
GO:0065009	0.457	regulation of molecular function
GO:1901342	0.441	regulation of vasculature development
GO:0006793	0.435	phosphorus metabolic process
GO:0010033	0.431	response to organic substance
GO:0060255	0.425	regulation of macromolecule metabolic process
GO:0006796	0.407	phosphate-containing compound metabolic process
GO:0080090	0.396	regulation of primary metabolic process
GO:2000147	0.390	positive regulation of cell motility
GO:0030335	0.380	positive regulation of cell migration
GO:0048523	0.378	negative regulation of cellular process
GO:0035556	0.373	intracellular signal transduction
GO:0009893	0.362	positive regulation of metabolic process
GO:1903169	0.357	regulation of calcium ion transmembrane transport
GO:0042127	0.356	regulation of cell population proliferation
GO:0031323	0.337	regulation of cellular metabolic process
GO:0007173	0.308	epidermal growth factor receptor signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005886	1.000	plasma membrane
GO:0005829	0.975	cytosol
GO:0043226	0.902	organelle
GO:0043227	0.874	membrane-bounded organelle
GO:0043229	0.830	intracellular organelle
GO:0043231	0.812	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:33179	0.997	a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + H2O = 1D-myo-inositol 1,4,5-trisphosphate + a 1,2-diacyl-sn-glycerol + H(+)
EC:3.1.4.11	0.997	phosphoinositide phospholipase C.

[back to server]