StarFunc result for job id P19235

User Input

>input (508 residues)
MDHLGASLWPQVGSLCLLLAGAAWAPPPNLPDPKFESKAALLAARGPEELLCFTERLEDL
VCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPL
ELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRY
EVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPV
SLLTPSDLDPLILTLSLILVVILVLLTVLALLSHRRALKQKIWPGIPSPESEFEGLFTTH
KGNFQLWLYQNDGCLWWSPCTPFTEDPPASLEVLSERCWGTMQAVEPGTDDEGPLLEPVG
SEHAQDTYLVLDKWLLPRNPPSEDLPGPGGSVDIVAMDEGSEASSCSSALASKPSPEGAS
AASFEYTILDPSSQLLRPWTLCPELPPTPPHLKYLYLVVSDSGISTDYSSGDSQGAQGGL
SDGPYSNPYENSLIPAAEPLPPSYVACS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19235	1.000	1.000	2.375E-85	508	1.000	1.000	P19235.pdb.gz	EPOR_HUMAN Erythropoietin receptor OS=Homo sapiens OX=9606 GN=EPOR PE=1 SV=1
2	AFDB:P14753	0.641	0.642	1.485E-69	507	0.817	0.819	P14753.pdb.gz	EPOR_MOUSE Erythropoietin receptor OS=Mus musculus OX=10090 GN=Epor PE=1 SV=1
3	AFDB:A0A0R4IRZ4	0.463	0.463	1.168E-32	509	0.281	0.281	A0A0R4IRZ4.pdb.gz
4	AFDB:Q4W815	0.394	0.382	2.911E-29	525	0.293	0.284	Q4W815.pdb.gz	EPOR_XENLA Erythropoietin receptor OS=Xenopus laevis OX=8355 GN=epor PE=2 SV=1
5	AFDB:Q01113	0.316	0.309	2.637E-18	521	0.209	0.203	Q01113.pdb.gz	IL9R_HUMAN Interleukin-9 receptor OS=Homo sapiens OX=9606 GN=IL9R PE=1 SV=3
6	AFDB:P19756	0.346	0.282	8.122E-18	638	0.185	0.147	P19756.pdb.gz	GHR_PIG Growth hormone receptor OS=Sus scrofa OX=9823 GN=GHR PE=1 SV=1
7	AFDB:Q9DE08	0.363	0.296	1.247E-17	638	0.197	0.157	Q9DE08.pdb.gz	Q9DE08_ONCMY Prolactin receptor OS=Oncorhynchus mykiss OX=8022 GN=PRLR PE=2 SV=1
8	AFDB:F1MQ39	0.334	0.273	3.099E-17	634	0.183	0.147	F1MQ39.pdb.gz	F1MQ39_BOVIN Growth hormone receptor OS=Bos taurus OX=9913 GN=GHR PE=3 SV=1
9	AFDB:P16310	0.341	0.277	8.128E-17	638	0.193	0.154	P16310.pdb.gz	GHR_RAT Growth hormone receptor OS=Rattus norvegicus OX=10116 GN=Ghr PE=1 SV=1
10	AFDB:A0A087X0H5	0.323	0.260	4.761E-16	645	0.175	0.138	A0A087X0H5.pdb.gz	A0A087X0H5_HUMAN Growth hormone receptor OS=Homo sapiens OX=9606 GN=GHR PE=1 SV=1
11	PDB:7u7nC	0.313	0.716	1.157E-10	200	0.094	0.240	7u7nC.pdb.gz
12	PDB:5mj3A	0.267	0.418	4.418E-9	302	0.077	0.129	5mj3A.pdb.gz
13	PDB:8eyyA	0.201	0.141	3.041E-7	775	0.059	0.039	8eyyA.pdb.gz
14	PDB:7z0lB	0.293	0.394	3.385E-7	370	0.081	0.111	7z0lB.pdb.gz
15	PDB:8dtlA	0.195	0.140	1.688E-6	741	0.065	0.045	8dtlA.pdb.gz
16	PDB:6pxvA	0.196	0.130	2.592E-6	823	0.059	0.036	6pxvA.pdb.gz
17	PDB:3besR	0.222	0.383	4.929E-6	250	0.047	0.096	3besR.pdb.gz
18	PDB:7bwaA	0.172	0.138	7.988E-5	674	0.069	0.052	7bwaA.pdb.gz
19	PDB:6pyhD	0.184	0.124	1.603E-4	798	0.071	0.045	6pyhD.pdb.gz
20	PDB:1aqkL	0.137	0.265	3.393E-4	216	0.043	0.102	1aqkL.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P14753	0.0	758	507	0.817	0.819	EPOR_MOUSE Erythropoietin receptor OS=Mus musculus OX=10090 GN=Epor PE=1 SV=1
2	P19235	0.0	1019	508	1.000	1.000	EPOR_HUMAN Erythropoietin receptor OS=Homo sapiens OX=9606 GN=EPOR PE=1 SV=1
3	Q07303	0.0	754	507	0.805	0.807	EPOR_RAT Erythropoietin receptor OS=Rattus norvegicus OX=10116 GN=Epor PE=2 SV=1
4	Q2VBQ8	9.51e-57	199	509	0.297	0.297	Q2VBQ8_DANRE Erythropoietin receptor OS=Danio rerio OX=7955 GN=epor PE=2 SV=1
5	Q4W815	5.40e-48	176	525	0.226	0.219	EPOR_XENLA Erythropoietin receptor OS=Xenopus laevis OX=8355 GN=epor PE=2 SV=1
6	Q08351	1.16e-11	69.7	625	0.152	0.123	TPOR_MOUSE Thrombopoietin receptor OS=Mus musculus OX=10090 GN=Mpl PE=2 SV=2
7	Q01113	5.40e-11	67.0	521	0.173	0.169	IL9R_HUMAN Interleukin-9 receptor OS=Homo sapiens OX=9606 GN=IL9R PE=1 SV=3
8	Q28172	3.75e-10	64.7	581	0.124	0.108	PRLR_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=1 SV=1
9	A0A1W2Q670	3.95e-10	64.3	460	0.122	0.135	A0A1W2Q670_RAT MPL proto-oncogene, thrombopoietin receptor OS=Rattus norvegicus OX=10116 GN=Mpl PE=4 SV=2
10	A0A1W2Q6N1	4.23e-10	64.7	644	0.122	0.096	A0A1W2Q6N1_RAT MPL proto-oncogene, thrombopoietin receptor OS=Rattus norvegicus OX=10116 GN=Mpl PE=3 SV=1
11	F1N4H8	1.57e-09	61.2	296	0.122	0.209	F1N4H8_BOVIN Prolactin receptor OS=Bos taurus OX=9913 GN=PRLR PE=3 SV=2
12	Q6EIY6	2.99e-09	62.0	614	0.177	0.147	Q6EIY6_DANRE Myeloproliferative leukemia virus oncogene, like OS=Danio rerio OX=7955 GN=mpll PE=2 SV=1
13	Q2PBN9	7.09e-09	60.5	581	0.124	0.108	Q2PBN9_BOVIN Prolactin receptor (Fragment) OS=Bos taurus OX=9913 GN=prlr PE=3 SV=1
14	P40238	1.26e-08	59.7	635	0.142	0.113	TPOR_HUMAN Thrombopoietin receptor OS=Homo sapiens OX=9606 GN=MPL PE=1 SV=1
15	Q01114	2.90e-08	58.5	468	0.126	0.137	IL9R_MOUSE Interleukin-9 receptor OS=Mus musculus OX=10090 GN=Il9r PE=1 SV=1
16	Q08501	4.53e-08	58.2	608	0.120	0.100	PRLR_MOUSE Prolactin receptor OS=Mus musculus OX=10090 GN=Prlr PE=1 SV=1
17	Q5JUY5	6.88e-08	57.4	628	0.138	0.111	Q5JUY5_HUMAN MPL proto-oncogene, thrombopoietin receptor OS=Homo sapiens OX=9606 GN=MPL PE=1 SV=2
18	A8WH93	1.49e-07	55.8	362	0.144	0.202	A8WH93_DANRE Interleukin 2 receptor gamma common.a OS=Danio rerio OX=7955 GN=il-2rgc.a PE=2 SV=1
19	P05710	2.89e-07	55.5	610	0.124	0.103	PRLR_RAT Prolactin receptor OS=Rattus norvegicus OX=10116 GN=Prlr PE=1 SV=2
20	P16471	3.50e-07	55.1	622	0.112	0.092	PRLR_HUMAN Prolactin receptor OS=Homo sapiens OX=9606 GN=PRLR PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09067 EpoR_lig-bind	6.9e-26	101.8	Erythropoietin receptor, ligand binding
2	PF00041 fn3	0.0033	29.1	Fibronectin type III domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000222139

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000252723	0.999	Erythropoietin
2	9606.ENSP00000341208	0.999	Signal transducer and activator of transcription 5A
3	9606.ENSP00000371067	0.999	Tyrosine-protein kinase JAK2
4	9606.ENSP00000288135	0.996	Mast/stem cell growth factor receptor Kit
5	9606.ENSP00000376345	0.995	Growth factor receptor-bound protein 2
6	9606.ENSP00000391592	0.995	Tyrosine-protein phosphatase non-receptor type 6
7	9606.ENSP00000293328	0.993	Signal transducer and activator of transcription 5B
8	9606.ENSP00000330341	0.990	Suppressor of cytokine signaling 3
9	9606.ENSP00000290401	0.989	Neuroplastin
10	9606.ENSP00000428924	0.989	Tyrosine-protein kinase Lyn
11	9606.ENSP00000346300	0.981	Crk-like protein
12	9606.ENSP00000428056	0.976	Phosphatidylinositol 3-kinase regulatory subunit alpha
13	9606.ENSP00000420525	0.974	Transferrin receptor protein 2
14	9606.ENSP00000244007	0.969	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
15	9606.ENSP00000228280	0.962	Kit ligand
16	9606.ENSP00000401303	0.962	SHC-transforming protein 1
17	9606.ENSP00000264033	0.956	E3 ubiquitin-protein ligase CBL
18	9606.ENSP00000365016	0.956	Insulin receptor substrate 2
19	9606.ENSP00000345492	0.954	SH2B adapter protein 3
20	9606.ENSP00000391676	0.946	Tyrosine-protein kinase JAK3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004896	1.000	cytokine receptor activity
GO:0004900	0.945	erythropoietin receptor activity
GO:0042802	0.930	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050896	0.992	response to stimulus
GO:0009987	0.991	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0032502	0.970	developmental process
GO:0051716	0.968	cellular response to stimulus
GO:0048518	0.953	positive regulation of biological process
GO:0032501	0.939	multicellular organismal process
GO:0048856	0.935	anatomical structure development
GO:0048522	0.892	positive regulation of cellular process
GO:0019222	0.882	regulation of metabolic process
GO:0042221	0.867	response to chemical
GO:0048583	0.862	regulation of response to stimulus
GO:0031323	0.858	regulation of cellular metabolic process
GO:0007165	0.827	signal transduction
GO:0048519	0.818	negative regulation of biological process
GO:0007275	0.790	multicellular organism development
GO:0007166	0.789	cell surface receptor signaling pathway
GO:0009893	0.780	positive regulation of metabolic process
GO:0048731	0.768	system development
GO:0051171	0.750	regulation of nitrogen compound metabolic process
GO:0048523	0.718	negative regulation of cellular process
GO:0010646	0.705	regulation of cell communication
GO:0009966	0.703	regulation of signal transduction
GO:0030154	0.700	cell differentiation
GO:0060255	0.676	regulation of macromolecule metabolic process
GO:0070887	0.676	cellular response to chemical stimulus
GO:0042127	0.667	regulation of cell population proliferation
GO:0080090	0.656	regulation of primary metabolic process
GO:0031325	0.612	positive regulation of cellular metabolic process
GO:0010033	0.557	response to organic substance
GO:0048513	0.551	animal organ development
GO:0010604	0.489	positive regulation of macromolecule metabolic process
GO:0008284	0.478	positive regulation of cell population proliferation
GO:0010468	0.477	regulation of gene expression
GO:0048584	0.474	positive regulation of response to stimulus
GO:0010941	0.470	regulation of cell death
GO:0051173	0.460	positive regulation of nitrogen compound metabolic process
GO:0071310	0.459	cellular response to organic substance
GO:0009888	0.455	tissue development
GO:0009653	0.441	anatomical structure morphogenesis
GO:0009967	0.437	positive regulation of signal transduction
GO:0006950	0.431	response to stress
GO:0060537	0.429	muscle tissue development
GO:0009889	0.421	regulation of biosynthetic process
GO:1902531	0.404	regulation of intracellular signal transduction
GO:0072359	0.402	circulatory system development
GO:0009887	0.391	animal organ morphogenesis
GO:0031326	0.382	regulation of cellular biosynthetic process
GO:0003205	0.354	cardiac chamber development
GO:0061061	0.346	muscle structure development
GO:0003007	0.346	heart morphogenesis
GO:0008152	0.343	metabolic process
GO:0051239	0.338	regulation of multicellular organismal process
GO:0010556	0.338	regulation of macromolecule biosynthetic process
GO:0043067	0.307	regulation of programmed cell death

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.984	intracellular anatomical structure
GO:0005737	0.957	cytoplasm
GO:0043226	0.906	organelle
GO:0043229	0.869	intracellular organelle
GO:0043227	0.776	membrane-bounded organelle
GO:0070013	0.722	intracellular organelle lumen
GO:0043231	0.721	intracellular membrane-bounded organelle
GO:0005829	0.716	cytosol
GO:0005654	0.668	nucleoplasm
GO:0016604	0.302	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]