StarFunc result for job id P19237

User Input

>input (187 residues)
MPEVERKPKITASRKLLLKSLMLAKAKECWEQEHEEREAEKVRYLAERIPTLQTRGLSLS
ALQDLCRELHAKVEVVDEERYDIEAKCLHNTREIKDLKLKVMDLRGKFKRPPLRRVRVSA
DAMLRALLGSKHKVSMDLRANLKSVKKEDTEKERPVEVGDWRKNVEAMSGMEGRKKMFDA
AKSPTSQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P13413	0.566	0.566	1.066E-24	187	0.973	0.973	P13413.pdb.gz	TNNI1_RAT Troponin I, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni1 PE=1 SV=2
2	AFDB:F8W4T8	0.538	0.552	4.104E-20	182	0.759	0.780	F8W4T8.pdb.gz
3	AFDB:A0A060VX54	0.504	0.432	1.585E-17	221	0.791	0.670	A0A060VX54.pdb.gz	A0A060VX54_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00080162001 PE=4 SV=1
4	AFDB:P02643	0.515	0.528	2.211E-13	182	0.556	0.571	P02643.pdb.gz	TNNI2_RABIT Troponin I, fast skeletal muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI2 PE=1 SV=3
5	AFDB:A0A060Y5I6	0.447	0.559	6.102E-13	148	0.540	0.682	A0A060Y5I6.pdb.gz	A0A060Y5I6_ONCMY Troponin I type 1a (skeletal, slow) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00003364001 PE=4 SV=1
6	AFDB:A0A060XSD9	0.495	0.464	3.546E-12	201	0.620	0.577	A0A060XSD9.pdb.gz	A0A060XSD9_ONCMY Troponin I, skeletal, slow c OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00049579001 PE=4 SV=1
7	AFDB:A0A060W3E5	0.519	0.543	4.974E-12	178	0.529	0.556	A0A060W3E5.pdb.gz	A0A060W3E5_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065901001 PE=4 SV=1
8	AFDB:A0A060VTL6	0.503	0.521	1.469E-11	180	0.492	0.511	A0A060VTL6.pdb.gz	A0A060VTL6_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077269001 PE=4 SV=1
9	AFDB:P08057	0.481	0.428	2.521E-10	212	0.594	0.524	P08057.pdb.gz	TNNI3_BOVIN Troponin I, cardiac muscle OS=Bos taurus OX=9913 GN=TNNI3 PE=1 SV=2
10	AFDB:A0A060XBA6	0.506	0.546	1.118E-9	172	0.476	0.517	A0A060XBA6.pdb.gz	A0A060XBA6_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023680001 PE=4 SV=1
11	PDB:7utlV	0.487	0.530	2.946E-9	170	0.588	0.647	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
12	PDB:7c4jC	0.111	0.133	4.674	154	0.118	0.143	7c4jC.pdb.gz
13	PDB:8escS	0.126	0.100	4.674	268	0.134	0.093	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.
14	PDB:6id0P	0.117	0.155	6.557	118	0.128	0.203	6id0P.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:5nrlG	0.178	0.092	7.016	372	0.166	0.083	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
16	PDB:7a5fA	0.231	0.261	8.033	162	0.091	0.105	7a5fA.pdb.gz	Elongational stalling activates mitoribosome-associated quality control.
17	PDB:1xq8A	0.228	0.286	8.595	140	0.086	0.114	1xq8A.pdb.gz
18	PDB:6wucH	0.247	0.257	8.595	179	0.102	0.106	6wucH.pdb.gz
19	PDB:7sqkH	0.202	0.191	9.197	201	0.171	0.159	7sqkH.pdb.gz
20	PDB:6qlfQ	0.261	0.240	9.841	204	0.102	0.093	6qlfQ.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19237	2.33e-134	375	187	1.000	1.000	TNNI1_HUMAN Troponin I, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNI1 PE=1 SV=3
2	Q9WUZ5	7.41e-132	369	187	0.979	0.979	TNNI1_MOUSE Troponin I, slow skeletal muscle OS=Mus musculus OX=10090 GN=Tnni1 PE=1 SV=3
3	P13413	8.56e-131	366	187	0.973	0.973	TNNI1_RAT Troponin I, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni1 PE=1 SV=2
4	Q5PR62	7.83e-102	293	182	0.770	0.791	Q5PR62_DANRE Troponin I type 1b (Skeletal, slow) OS=Danio rerio OX=7955 GN=zgc:103458 PE=1 SV=1
5	A0A060VX54	1.89e-101	293	221	0.786	0.665	A0A060VX54_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00080162001 PE=4 SV=1
6	D5M8S7	2.24e-101	291	189	0.797	0.788	D5M8S7_ONCMY Cardiac troponin I OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
7	A0A060XSD9	3.27e-75	226	201	0.620	0.577	A0A060XSD9_ONCMY Troponin I, skeletal, slow c OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00049579001 PE=4 SV=1
8	P48788	2.19e-67	205	182	0.567	0.582	TNNI2_HUMAN Troponin I, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNI2 PE=1 SV=2
9	P02643	8.97e-67	204	182	0.567	0.582	TNNI2_RABIT Troponin I, fast skeletal muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI2 PE=1 SV=3
10	P08057	1.38e-66	204	212	0.599	0.528	TNNI3_BOVIN Troponin I, cardiac muscle OS=Bos taurus OX=9913 GN=TNNI3 PE=1 SV=2
11	A0A060Y5I6	1.97e-66	202	148	0.540	0.682	A0A060Y5I6_ONCMY Troponin I type 1a (skeletal, slow) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00003364001 PE=4 SV=1
12	P23693	6.43e-65	200	211	0.599	0.531	TNNI3_RAT Troponin I, cardiac muscle OS=Rattus norvegicus OX=10116 GN=Tnni3 PE=1 SV=2
13	P48787	7.57e-65	200	211	0.599	0.531	TNNI3_MOUSE Troponin I, cardiac muscle OS=Mus musculus OX=10090 GN=Tnni3 PE=1 SV=2
14	P02646	4.02e-63	196	211	0.594	0.526	TNNI3_RABIT Troponin I, cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI3 PE=1 SV=2
15	P27768	1.41e-61	191	182	0.561	0.577	TNNI2_RAT Troponin I, fast skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni2 PE=1 SV=2
16	P19429	3.89e-61	191	210	0.604	0.538	TNNI3_HUMAN Troponin I, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNI3 PE=1 SV=3
17	Q6FGX2	3.89e-61	191	210	0.604	0.538	Q6FGX2_HUMAN Troponin I, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNI3 PE=1 SV=1
18	Q0D2W2	3.47e-60	187	176	0.535	0.568	Q0D2W2_DANRE Fast muscle troponin I OS=Danio rerio OX=7955 GN=hm:zehn0173 PE=1 SV=1
19	A0A060X4F4	8.58e-59	183	178	0.529	0.556	A0A060X4F4_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023684001 PE=4 SV=1
20	A0A060Y0V6	1.73e-53	170	180	0.524	0.544	A0A060Y0V6_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00034099001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00992 Troponin	4.6e-45	164.5	Troponin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010377173.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010360993.1	0.995	Troponin T2, cardiac type
2	61622.XP_010377475.1	0.993	Troponin T1, slow skeletal type
3	61622.XP_010376540.1	0.990	Troponin T, fast skeletal muscle-like
4	61622.XP_010380343.1	0.990	Troponin T3, fast skeletal type
5	61622.XP_010363314.1	0.978	Troponin C1, slow skeletal and cardiac type
6	61622.XP_010376719.1	0.952	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
7	61622.XP_010382511.1	0.931	Troponin C2, fast skeletal type
8	61622.XP_010377898.1	0.930	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
9	61622.XP_010364853.1	0.928	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
10	61622.XP_010376720.1	0.928	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 3 bases in 2 codons
11	61622.XP_010374601.1	0.922	Belongs to the tropomyosin family.
12	61622.XP_010372522.1	0.919	Belongs to the tropomyosin family.
13	61622.XP_010359804.1	0.917	Belongs to the tropomyosin family.
14	61622.XP_010363022.1	0.917	Belongs to the tropomyosin family.
15	61622.XP_010380335.1	0.907	Troponin I2, fast skeletal type
16	61622.XP_010382980.1	0.899	Alpha-actinin-2
17	61622.XP_010357705.1	0.891	Myosin light chain alkali-like
18	61622.XP_010353223.1	0.879	Myosin light chain 1
19	61622.XP_010377894.1	0.845	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family
20	61622.XP_010377895.1	0.842	Belongs to the TRAFAC class myosin-kinesin ATPase superfamily. Myosin family

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008092	0.995	cytoskeletal protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.996	regulation of biological process
GO:0044057	0.984	regulation of system process
GO:0032501	0.977	multicellular organismal process
GO:0090257	0.944	regulation of muscle system process
GO:0048856	0.736	anatomical structure development
GO:0009987	0.597	cellular process
GO:0006937	0.541	regulation of muscle contraction
GO:0007275	0.498	multicellular organism development
GO:0003012	0.474	muscle system process
GO:0006936	0.447	muscle contraction
GO:0048513	0.439	animal organ development
GO:0007507	0.415	heart development
GO:0061061	0.369	muscle structure development
GO:0050794	0.369	regulation of cellular process
GO:0006941	0.336	striated muscle contraction
GO:0007517	0.334	muscle organ development
GO:0060537	0.333	muscle tissue development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0036379	0.996	myofilament
GO:0032991	0.993	protein-containing complex
GO:0015629	0.987	actin cytoskeleton
GO:0030017	0.981	sarcomere
GO:0005865	0.938	striated muscle thin filament
GO:0005861	0.891	troponin complex
GO:0043227	0.711	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]