StarFunc result for job id P19256

User Input

>input (250 residues)
MVAGSDAGRALGVLSVVCLLHCFGFISCFSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQK
DKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYV
LESLPSPTLTCALTNGSIEVQCMIPEHYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMEND
LPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRYALIPIPLAVITTCIVLYMNGILKC
DRKPDRTNSN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19256	1.000	1.000	1.493E-48	250	1.000	1.000	P19256.pdb.gz	LFA3_HUMAN Lymphocyte function-associated antigen 3 OS=Homo sapiens OX=9606 GN=CD58 PE=1 SV=1
2	AFDB:A4JYL8	0.665	0.368	3.281E-19	475	0.244	0.128	A4JYL8.pdb.gz
3	AFDB:Q18PI6	0.618	0.478	2.081E-16	329	0.216	0.164	Q18PI6.pdb.gz	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
4	AFDB:A0A0D5CDW0	0.573	0.442	2.029E-15	333	0.216	0.162	A0A0D5CDW0.pdb.gz	A0A0D5CDW0_ICTPU SLAM family member 7 precursor OS=Ictalurus punctatus OX=7998 GN=slamf7 PE=2 SV=1
5	AFDB:Q01965	0.606	0.265	2.810E-15	654	0.192	0.073	Q01965.pdb.gz	LY9_MOUSE T-lymphocyte surface antigen Ly-9 OS=Mus musculus OX=10090 GN=Ly9 PE=1 SV=2
6	AFDB:Q07763	0.534	0.367	3.890E-15	397	0.204	0.128	Q07763.pdb.gz	CD244_MOUSE Natural killer cell receptor 2B4 OS=Mus musculus OX=10090 GN=Cd244 PE=1 SV=3
7	AFDB:Q9HBG7	0.626	0.260	4.577E-15	655	0.192	0.073	Q9HBG7.pdb.gz	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
8	AFDB:Q9NQ25	0.599	0.460	5.386E-15	335	0.192	0.143	Q9NQ25.pdb.gz	SLAF7_HUMAN SLAM family member 7 OS=Homo sapiens OX=9606 GN=SLAMF7 PE=1 SV=1
9	AFDB:P10252	0.590	0.611	5.686E-15	240	0.208	0.217	P10252.pdb.gz	CD48_RAT CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1
10	AFDB:P09326	0.547	0.561	6.002E-15	243	0.196	0.202	P09326.pdb.gz	CD48_HUMAN CD48 antigen OS=Homo sapiens OX=9606 GN=CD48 PE=1 SV=2
11	PDB:6dldD	0.451	0.425	5.963E-9	269	0.108	0.100	6dldD.pdb.gz
12	PDB:3c2aL	0.312	0.352	1.083E-8	216	0.136	0.157	3c2aL.pdb.gz	Structure determination of an anti-HIV-1 Fab 447-52D-peptide complex from an epitaxially twinned data set
13	PDB:1k4dB	0.307	0.356	1.143E-8	212	0.120	0.142	1k4dB.pdb.gz
14	PDB:4r2gP	0.318	0.371	1.499E-8	210	0.100	0.119	4r2gP.pdb.gz	Structural Evolution of Glycan Recognition by a Family of Potent HIV Antibodies.
15	PDB:1fdlL	0.304	0.349	1.671E-8	214	0.128	0.150	1fdlL.pdb.gz
16	PDB:1fj1A	0.317	0.365	1.966E-8	213	0.108	0.127	1fj1A.pdb.gz
17	PDB:1ngwH	0.322	0.366	2.075E-8	216	0.124	0.144	1ngwH.pdb.gz	Structural evidence for substrate strain in antibody catalysis
18	PDB:2qhrL	0.321	0.355	2.313E-8	218	0.116	0.133	2qhrL.pdb.gz	Complex of a protective antibody with its Ebola virus GP peptide epitope: unusual features of a V lambda x light chain.
19	PDB:1c12A	0.260	0.296	2.578E-8	214	0.120	0.140	1c12A.pdb.gz	Insight into odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide.
20	PDB:6dlfA	0.384	0.402	2.578E-8	236	0.096	0.102	6dlfA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19256	0.0	521	250	1.000	1.000	LFA3_HUMAN Lymphocyte function-associated antigen 3 OS=Homo sapiens OX=9606 GN=CD58 PE=1 SV=1
2	A0A0D5CDW0	1.07e-04	45.1	333	0.184	0.138	A0A0D5CDW0_ICTPU SLAM family member 7 precursor OS=Ictalurus punctatus OX=7998 GN=slamf7 PE=2 SV=1
3	P09326	0.002	40.8	243	0.152	0.156	CD48_HUMAN CD48 antigen OS=Homo sapiens OX=9606 GN=CD48 PE=1 SV=2
4	P18181	0.002	41.2	240	0.148	0.154	CD48_MOUSE CD48 antigen OS=Mus musculus OX=10090 GN=Cd48 PE=1 SV=1
5	Q18PI6	0.083	36.2	329	0.152	0.116	SLAF5_MOUSE SLAM family member 5 OS=Mus musculus OX=10090 GN=Cd84 PE=1 SV=1
6	P10252	0.087	35.8	240	0.084	0.087	CD48_RAT CD48 antigen OS=Rattus norvegicus OX=10116 GN=Cd48 PE=1 SV=1
7	Q9HBG7	0.29	34.7	655	0.192	0.073	LY9_HUMAN T-lymphocyte surface antigen Ly-9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
8	Q6PEV8	0.48	33.9	388	0.100	0.064	F199X_HUMAN Protein FAM199X OS=Homo sapiens OX=9606 GN=FAM199X PE=1 SV=1
9	Q5VYH9	0.85	33.1	565	0.188	0.083	Q5VYH9_HUMAN Lymphocyte antigen 9 OS=Homo sapiens OX=9606 GN=LY9 PE=1 SV=3
10	P33681	1.1	32.7	288	0.064	0.056	CD80_HUMAN T-lymphocyte activation antigen CD80 OS=Homo sapiens OX=9606 GN=CD80 PE=1 SV=1
11	O70361	3.1	31.6	1113	0.148	0.033	PER3_MOUSE Period circadian protein homolog 3 OS=Mus musculus OX=10090 GN=Per3 PE=1 SV=2
12	P12960	3.7	31.6	1020	0.092	0.023	CNTN1_MOUSE Contactin-1 OS=Mus musculus OX=10090 GN=Cntn1 PE=1 SV=1
13	Q63198	3.9	31.2	1021	0.092	0.023	CNTN1_RAT Contactin-1 OS=Rattus norvegicus OX=10116 GN=Cntn1 PE=1 SV=2
14	Q6DRI3	4.1	30.8	367	0.076	0.052	Q6DRI3_DANRE RNA 3'-terminal phosphate cyclase-like protein OS=Danio rerio OX=7955 GN=zgc:109921 PE=1 SV=1
15	Q12860	5.8	30.8	1018	0.088	0.022	CNTN1_HUMAN Contactin-1 OS=Homo sapiens OX=9606 GN=CNTN1 PE=1 SV=1
16	Q96RW7	9.3	30.4	5635	0.188	0.008	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05588 Botulinum_HA-17	47	15.5	Clostridium botulinum HA-17 domain
2	PF07679 I-set	31	16.1	Immunoglobulin I-set domain
3	PF13927 Ig_3	70	15.4	Immunoglobulin domain
4	PF07686 V-set	3.2e+02	12.9	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358501

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358490	0.999	T-cell surface antigen CD2
2	9606.ENSP00000324890	0.912	T-cell-specific surface glycoprotein CD28
3	9606.ENSP00000264832	0.845	Intercellular adhesion molecule 1
4	9606.ENSP00000303939	0.829	Cytotoxic T-lymphocyte protein 4
5	9606.ENSP00000484431	0.824	CD48 antigen
6	9606.ENSP00000264246	0.761	T-lymphocyte activation antigen CD80
7	9606.ENSP00000349252	0.733	Integrin alpha-L
8	9606.ENSP00000011653	0.700	T-cell surface glycoprotein CD4
9	9606.ENSP00000332049	0.695	T-lymphocyte activation antigen CD86
10	9606.ENSP00000320084	0.694	CD276 antigen
11	9606.ENSP00000361359	0.666	Tumor necrosis factor receptor superfamily member 5
12	9606.ENSP00000386559	0.654	T-cell surface glycoprotein CD8 alpha chain
13	9606.ENSP00000304903	0.641	CD2 antigen cytoplasmic tail-binding protein 2
14	9606.ENSP00000226730	0.637	Interleukin-2
15	9606.ENSP00000379191	0.636	CD59 glycoprotein
16	9606.ENSP00000263285	0.628	T-lymphocyte surface antigen Ly-9
17	9606.ENSP00000418525	0.622	Neprilysin
18	9606.ENSP00000160262	0.610	Intercellular adhesion molecule 3
19	9606.ENSP00000398632	0.585	CD44 antigen
20	9606.ENSP00000285670	0.572	SAM domain-containing protein SAMSN-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005102	0.999	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0001817	0.996	regulation of cytokine production
GO:0048518	0.995	positive regulation of biological process
GO:0051716	0.993	cellular response to stimulus
GO:0051240	0.991	positive regulation of multicellular organismal process
GO:0010604	0.987	positive regulation of macromolecule metabolic process
GO:0006952	0.985	defense response
GO:0010628	0.984	positive regulation of gene expression
GO:0042221	0.982	response to chemical
GO:0007155	0.975	cell adhesion
GO:0006955	0.975	immune response
GO:0034097	0.974	response to cytokine
GO:0001819	0.973	positive regulation of cytokine production
GO:0032677	0.940	regulation of interleukin-8 production
GO:0009605	0.906	response to external stimulus
GO:0009607	0.891	response to biotic stimulus
GO:0044419	0.848	biological process involved in interspecies interaction between organisms
GO:0051707	0.770	response to other organism
GO:0050794	0.755	regulation of cellular process
GO:0070887	0.740	cellular response to chemical stimulus
GO:0071310	0.726	cellular response to organic substance
GO:0034612	0.661	response to tumor necrosis factor
GO:0032757	0.633	positive regulation of interleukin-8 production
GO:0098542	0.614	defense response to other organism
GO:0045087	0.587	innate immune response
GO:0098609	0.535	cell-cell adhesion
GO:0071345	0.533	cellular response to cytokine stimulus
GO:0048522	0.499	positive regulation of cellular process
GO:0032501	0.454	multicellular organismal process
GO:0034341	0.376	response to type II interferon
GO:0071346	0.330	cellular response to type II interferon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0009986	0.998	cell surface
GO:0012505	0.997	endomembrane system
GO:0031982	0.997	vesicle
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005737	0.996	cytoplasm
GO:0070062	0.992	extracellular exosome
GO:0098588	0.990	bounding membrane of organelle
GO:0030659	0.989	cytoplasmic vesicle membrane
GO:0099503	0.985	secretory vesicle
GO:0030667	0.979	secretory granule membrane
GO:0070820	0.962	tertiary granule
GO:0101002	0.933	ficolin-1-rich granule
GO:0101003	0.832	ficolin-1-rich granule membrane
GO:0070013	0.327	intracellular organelle lumen
GO:0032991	0.300	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]