StarFunc result for job id P19320

User Input

>input (739 residues)
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19320	1.000	1.000	0.000	739	1.000	1.000	P19320.pdb.gz	VCAM1_HUMAN Vascular cell adhesion protein 1 OS=Homo sapiens OX=9606 GN=VCAM1 PE=1 SV=1
2	AFDB:P29533	0.472	0.472	0.000	739	0.759	0.759	P29533.pdb.gz	VCAM1_MOUSE Vascular cell adhesion protein 1 OS=Mus musculus OX=10090 GN=Vcam1 PE=1 SV=1
3	AFDB:P29534	0.623	0.623	0.000	739	0.769	0.769	P29534.pdb.gz	VCAM1_RAT Vascular cell adhesion protein 1 OS=Rattus norvegicus OX=10116 GN=Vcam1 PE=1 SV=1
4	AFDB:A2RV50	0.313	0.290	1.064E-58	808	0.248	0.226	A2RV50.pdb.gz
5	AFDB:P35329	0.287	0.257	5.520E-35	862	0.202	0.173	P35329.pdb.gz	CD22_MOUSE B-cell receptor CD22 OS=Mus musculus OX=10090 GN=Cd22 PE=1 SV=2
6	AFDB:P20273	0.280	0.253	1.745E-33	847	0.204	0.178	P20273.pdb.gz	CD22_HUMAN B-cell receptor CD22 OS=Homo sapiens OX=9606 GN=CD22 PE=1 SV=2
7	AFDB:Q90YM0	0.332	0.312	2.495E-32	795	0.188	0.175	Q90YM0.pdb.gz	Q90YM0_DANRE Cell adhesion molecule OCAM OS=Danio rerio OX=7955 GN=sb:eu836 PE=2 SV=1
8	AFDB:P13595	0.327	0.234	1.278E-31	1115	0.189	0.126	P13595.pdb.gz	NCAM1_MOUSE Neural cell adhesion molecule 1 OS=Mus musculus OX=10090 GN=Ncam1 PE=1 SV=3
9	AFDB:F1LTJ5	0.185	0.068	1.201E-30	2449	0.192	0.058	F1LTJ5.pdb.gz	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
10	AFDB:P13590	0.324	0.232	1.258E-30	1091	0.183	0.124	P13590.pdb.gz	NCAM1_CHICK Neural cell adhesion molecule 1 OS=Gallus gallus OX=9031 GN=NCAM1 PE=1 SV=3
11	PDB:1e07A	0.333	0.366	1.813E-25	642	0.152	0.174	1e07A.pdb.gz
12	PDB:5oj2B	0.186	0.195	1.191E-22	692	0.191	0.204	5oj2B.pdb.gz
13	PDB:7sqcO0	0.184	0.139	2.051E-15	1140	0.108	0.070	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
14	PDB:7nycA	0.131	0.076	3.534E-14	1542	0.129	0.062	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
15	PDB:6h03A	0.142	0.100	7.458E-14	1223	0.129	0.078	6h03A.pdb.gz
16	PDB:5a42A	0.151	0.086	2.082E-13	1597	0.118	0.054	5a42A.pdb.gz
17	PDB:4ziqA	0.137	0.083	2.629E-13	1450	0.104	0.053	4ziqA.pdb.gz
18	PDB:7q5zA	0.141	0.089	4.002E-13	1344	0.124	0.068	7q5zA.pdb.gz
19	PDB:7q1yA	0.153	0.092	5.295E-13	1374	0.129	0.069	7q1yA.pdb.gz
20	PDB:4lnvA	0.131	0.087	8.445E-13	1276	0.112	0.065	4lnvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19320	0.0	1514	739	1.000	1.000	VCAM1_HUMAN Vascular cell adhesion protein 1 OS=Homo sapiens OX=9606 GN=VCAM1 PE=1 SV=1
2	P29533	0.0	1165	739	0.759	0.759	VCAM1_MOUSE Vascular cell adhesion protein 1 OS=Mus musculus OX=10090 GN=Vcam1 PE=1 SV=1
3	P29534	0.0	1181	739	0.769	0.769	VCAM1_RAT Vascular cell adhesion protein 1 OS=Rattus norvegicus OX=10116 GN=Vcam1 PE=1 SV=1
4	A5PMX0	4.10e-63	228	808	0.192	0.176	A5PMX0_DANRE Vascular cell adhesion molecule 1b OS=Danio rerio OX=7955 GN=fi76d06 PE=4 SV=1
5	A4JYI2	5.30e-63	227	808	0.189	0.173	A4JYI2_DANRE Vascular cell adhesion protein 1 precursor OS=Danio rerio OX=7955 GN=zgc:158875 PE=2 SV=1
6	F6NRL9	6.04e-42	160	440	0.161	0.270	F6NRL9_DANRE Vascular cell adhesion molecule 1a OS=Danio rerio OX=7955 GN=vcam1a PE=4 SV=1
7	A2AJ76	1.73e-29	129	5100	0.169	0.025	HMCN2_MOUSE Hemicentin-2 OS=Mus musculus OX=10090 GN=Hmcn2 PE=1 SV=1
8	D3YXG0	3.50e-25	115	5634	0.214	0.028	HMCN1_MOUSE Hemicentin-1 OS=Mus musculus OX=10090 GN=Hmcn1 PE=1 SV=1
9	Q96RW7	5.11e-25	114	5635	0.223	0.029	HMCN1_HUMAN Hemicentin-1 OS=Homo sapiens OX=9606 GN=HMCN1 PE=1 SV=2
10	Q8NDA2	2.60e-24	112	5059	0.156	0.023	HMCN2_HUMAN Hemicentin-2 OS=Homo sapiens OX=9606 GN=HMCN2 PE=2 SV=3
11	Q9NR99	3.18e-24	112	2828	0.234	0.061	MXRA5_HUMAN Matrix-remodeling-associated protein 5 OS=Homo sapiens OX=9606 GN=MXRA5 PE=1 SV=3
12	E7F3V2	2.38e-23	109	4212	0.202	0.035	E7F3V2_DANRE Hemicentin 2 OS=Danio rerio OX=7955 GN=hmcn2 PE=1 SV=2
13	P98160	1.81e-22	106	4391	0.158	0.027	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
14	G5ED27	2.80e-22	105	5175	0.208	0.030	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
15	G5EG33	3.69e-22	105	5198	0.208	0.030	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
16	G5EDG4	8.26e-21	100	3962	0.218	0.041	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
17	Q6WRI0	9.22e-21	100	2623	0.215	0.061	IGS10_HUMAN Immunoglobulin superfamily member 10 OS=Homo sapiens OX=9606 GN=IGSF10 PE=1 SV=1
18	Q05793	1.21e-20	100	3707	0.158	0.032	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
19	P20273	2.63e-19	95.5	847	0.203	0.177	CD22_HUMAN B-cell receptor CD22 OS=Homo sapiens OX=9606 GN=CD22 PE=1 SV=2
20	Q0E9J6	3.05e-19	95.9	2017	0.206	0.075	Q0E9J6_DROME Down syndrome cell adhesion molecule 1, isoform AD OS=Drosophila melanogaster OX=7227 GN=Dscam1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02440 Adeno_E3_CR1	81	14.4	Adenovirus E3 region protein CR1
2	PF09085 Adhes-Ig_like	0.00021	32.7	Adhesion molecule, immunoglobulin-like
3	PF07654 C1-set	0.0058	28.3	Immunoglobulin C1-set domain
4	PF05790 C2-set	5.3e-50	178.8	Immunoglobulin C2-set domain
5	PF08205 C2-set_2	3.8e-09	47.8	CD80-like C2-set immunoglobulin domain
6	PF07679 I-set	2.8e-55	195.7	Immunoglobulin I-set domain
7	PF03921 ICAM_N	7.4e-09	46.5	Intercellular adhesion molecule (ICAM), N-terminal domain
8	PF00047 ig	5.1e-44	159.7	Immunoglobulin domain
9	PF13895 Ig_2	3.2e-36	134.8	Immunoglobulin domain
10	PF13927 Ig_3	2e-51	183.8	Immunoglobulin domain
11	PF16680 Ig_4	2.3e-06	39.4	T-cell surface glycoprotein CD3 delta chain
12	PF16681 Ig_5	1.8e-07	42.8	Ig-like domain on T-cell surface glycoprotein CD3 epsilon chain
13	PF18452 Ig_6	5.3e-07	41.0	Immunoglobulin domain
14	PF16706 Izumo-Ig	0.014	26.7	Izumo-like Immunoglobulin domain
15	PF11465 Receptor_2B4	0.37	22.4	Natural killer cell receptor 2B4
16	PF02080 TrkA_C	2.7e+02	12.9	TrkA-C domain
17	PF07686 V-set	1.4e-18	78.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000294728

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380227	0.999	Integrin alpha-4
2	9606.ENSP00000379350	0.997	Integrin beta-1
3	9606.ENSP00000380948	0.996	Integrin beta-2
4	9606.ENSP00000356042	0.992	Ezrin
5	9606.ENSP00000454623	0.988	Integrin alpha-X
6	9606.ENSP00000398698	0.987	Tumor necrosis factor
7	9606.ENSP00000373854	0.982	Integrin alpha-D
8	9606.ENSP00000264741	0.970	Integrin alpha-9
9	9606.ENSP00000441691	0.968	Integrin alpha-M
10	9606.ENSP00000304915	0.965	Interleukin-13
11	9606.ENSP00000367851	0.956	Cytochrome b-245 heavy chain
12	9606.ENSP00000346839	0.954	Fibronectin type III domain containing
13	9606.ENSP00000362680	0.954	Proto-oncogene tyrosine-protein kinase Src
14	9606.ENSP00000353408	0.952	Moesin
15	9606.ENSP00000398632	0.952	CD44 antigen
16	9606.ENSP00000349252	0.951	Integrin alpha-L
17	9606.ENSP00000267082	0.947	Integrin beta-7
18	9606.ENSP00000289473	0.946	Neutrophil cytosol factor 1
19	9606.ENSP00000260356	0.944	Thrombospondin-1
20	9606.ENSP00000261623	0.942	Cytochrome b-245 light chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005178	1.000	integrin binding
GO:0016638	0.996	oxidoreductase activity, acting on the CH-NH2 group of donors
GO:0008131	0.971	primary amine oxidase activity
GO:0042802	0.425	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.996	response to stimulus
GO:0042221	0.992	response to chemical
GO:0032501	0.984	multicellular organismal process
GO:0050789	0.979	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0032502	0.969	developmental process
GO:0048518	0.967	positive regulation of biological process
GO:0007155	0.956	cell adhesion
GO:0048856	0.954	anatomical structure development
GO:0048522	0.953	positive regulation of cellular process
GO:0098742	0.951	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0007154	0.944	cell communication
GO:0007157	0.941	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0010033	0.908	response to organic substance
GO:0051239	0.903	regulation of multicellular organismal process
GO:0051716	0.893	cellular response to stimulus
GO:0009605	0.870	response to external stimulus
GO:0030154	0.831	cell differentiation
GO:0023052	0.825	signaling
GO:0050900	0.817	leukocyte migration
GO:0007165	0.810	signal transduction
GO:0008284	0.803	positive regulation of cell population proliferation
GO:0002684	0.800	positive regulation of immune system process
GO:0007159	0.780	leukocyte cell-cell adhesion
GO:0022407	0.777	regulation of cell-cell adhesion
GO:0007275	0.764	multicellular organism development
GO:0009719	0.759	response to endogenous stimulus
GO:0051240	0.755	positive regulation of multicellular organismal process
GO:0050865	0.747	regulation of cell activation
GO:0045785	0.745	positive regulation of cell adhesion
GO:0071310	0.695	cellular response to organic substance
GO:0002694	0.677	regulation of leukocyte activation
GO:1903037	0.673	regulation of leukocyte cell-cell adhesion
GO:1901700	0.668	response to oxygen-containing compound
GO:0048468	0.665	cell development
GO:0071495	0.661	cellular response to endogenous stimulus
GO:1901701	0.656	cellular response to oxygen-containing compound
GO:0022409	0.630	positive regulation of cell-cell adhesion
GO:0051249	0.601	regulation of lymphocyte activation
GO:0050867	0.582	positive regulation of cell activation
GO:0008152	0.566	metabolic process
GO:1903039	0.563	positive regulation of leukocyte cell-cell adhesion
GO:0071704	0.520	organic substance metabolic process
GO:0002696	0.509	positive regulation of leukocyte activation
GO:0019222	0.507	regulation of metabolic process
GO:0006950	0.494	response to stress
GO:0070663	0.492	regulation of leukocyte proliferation
GO:0051251	0.488	positive regulation of lymphocyte activation
GO:0060255	0.483	regulation of macromolecule metabolic process
GO:0050863	0.479	regulation of T cell activation
GO:0070665	0.448	positive regulation of leukocyte proliferation
GO:0032944	0.446	regulation of mononuclear cell proliferation
GO:0050670	0.443	regulation of lymphocyte proliferation
GO:0009893	0.427	positive regulation of metabolic process
GO:0045123	0.398	cellular extravasation
GO:0050671	0.395	positive regulation of lymphocyte proliferation
GO:0048583	0.393	regulation of response to stimulus
GO:0048731	0.371	system development
GO:0048519	0.353	negative regulation of biological process
GO:0006807	0.351	nitrogen compound metabolic process
GO:0001775	0.340	cell activation
GO:0048513	0.302	animal organ development
GO:0010604	0.301	positive regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005576	0.976	extracellular region
GO:0043226	0.914	organelle
GO:0043227	0.901	membrane-bounded organelle
GO:0005622	0.816	intracellular anatomical structure
GO:0005615	0.765	extracellular space
GO:0031982	0.759	vesicle
GO:0043231	0.751	intracellular membrane-bounded organelle
GO:0005737	0.719	cytoplasm
GO:0065010	0.695	extracellular membrane-bounded organelle
GO:0070062	0.684	extracellular exosome
GO:0009986	0.478	cell surface

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.4.-.-	0.996	Acting on the CH-NH2 group of donors.
EC:1.4.3.21	0.971	primary-amine oxidase.

[back to server]