StarFunc result for job id P19338

User Input

>input (710 residues)
MVKLAKAGKNQGDPKKMAPPPKEVEEDSEDEEMSEDEEDDSSGEEVVIPQKKGKKAAATS
AKKVVVSPTKKVAVATPAKKAAVTPGKKAAATPAKKTVTPAKAVTTPGKKGATPGKALVA
TPGKKGAAIPAKGAKNGKNAKKEDSDEEEDDDSEEDEEDDEDEDEDEDEIEPAAMKAAAA
APASEDEDDEDDEDDEDDDDDEEDDSEEEAMETTPAKGKKAAKVVPVKAKNVAEDEDEEE
DDEDEDDDDDEDDEDDDDEDDEEEEEEEEEEPVKEAPGKRKKEMAKQKAAPEAKKQKVEG
TEPTTAFNLFVGNLNFNKSAPELKTGISDVFAKNDLAVVDVRIGMTRKFGYVDFESAEDL
EKALELTGLKVFGNEIKLEKPKGKDSKKERDARTLLAKNLPYKVTQDELKEVFEDAAEIR
LVSKDGKSKGIAYIEFKTEADAEKTFEEKQGTEIDGRSISLYYTGEKGQNQDYRGGKNST
WSGESKTLVLSNLSYSATEETLQEVFEKATFIKVPQNQNGKSKGYAFIEFASFEDAKEAL
NSCNKREIEGRAIRLELQGPRGSPNARSQPSKTLFVKGLSEDTTEETLKESFDGSVRARI
VTDRETGSSKGFGFVDFNSEEDAKAAKEAMEDGEIDGNKVTLDWAKPKGEGGFGGRGGGR
GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P19338	0.999	0.999	0.000	710	1.000	1.000	P19338.pdb.gz	NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3
2	AFDB:H7BY16	0.375	0.364	9.449E-102	734	1.000	0.967	H7BY16.pdb.gz	H7BY16_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=9
3	AFDB:P13383	0.478	0.476	2.317E-89	713	0.849	0.846	P13383.pdb.gz	NUCL_RAT Nucleolin OS=Rattus norvegicus OX=10116 GN=Ncl PE=1 SV=3
4	PDB:5vsuA	0.124	0.200	1.234E-17	387	0.094	0.173	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
5	PDB:6r5kH	0.178	0.263	1.048E-16	394	0.124	0.223	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
6	AFDB:Q8IXT5	0.111	0.082	1.512E-16	1001	0.106	0.075	Q8IXT5.pdb.gz	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
7	PDB:7oqcF	0.107	0.271	3.716E-11	267	0.068	0.180	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
8	PDB:6y53o	0.105	0.435	8.046E-11	160	0.065	0.287	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
9	PDB:5lsbA	0.100	0.389	6.070E-10	176	0.059	0.239	5lsbA.pdb.gz
10	PDB:7evoD	0.103	0.354	1.416E-8	200	0.042	0.150	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
11	AFDB:D3ZHK8	0.107	0.106	1.611E-8	717	0.149	0.148	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
12	AFDB:A0A0G2K3Y6	0.109	0.107	3.488E-8	729	0.130	0.126	A0A0G2K3Y6.pdb.gz	A0A0G2K3Y6_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
13	PDB:6y5qq	0.105	0.388	4.934E-8	178	0.044	0.174	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
14	AFDB:A0A0G2K850	0.104	0.113	1.452E-7	651	0.169	0.184	A0A0G2K850.pdb.gz	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
15	PDB:6ff7X	0.100	0.383	1.936E-7	171	0.049	0.205	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	AFDB:P78332	0.121	0.080	2.075E-7	1123	0.163	0.103	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
17	AFDB:Q4QRG0	0.107	0.130	4.493E-7	579	0.179	0.219	Q4QRG0.pdb.gz	Q4QRG0_DANRE EWS RNA-binding protein 1b OS=Danio rerio OX=7955 GN=fb40b11 PE=1 SV=1
18	AFDB:A0A140UHY3	0.106	0.114	7.670E-7	661	0.161	0.172	A0A140UHY3.pdb.gz	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
19	PDB:5yzg1	0.102	0.293	1.022E-6	243	0.063	0.185	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
20	PDB:6qx91K	0.113	0.381	1.022E-6	201	0.034	0.119	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JLB1	0.0	1349	694	0.977	1.000	C9JLB1_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=2
2	H7BY16	0.0	1369	734	1.000	0.967	H7BY16_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=9
3	P09405	0.0	819	707	0.725	0.728	NUCL_MOUSE Nucleolin OS=Mus musculus OX=10090 GN=Ncl PE=1 SV=2
4	P13383	0.0	828	713	0.742	0.739	NUCL_RAT Nucleolin OS=Rattus norvegicus OX=10116 GN=Ncl PE=1 SV=3
5	P19338	0.0	1379	710	1.000	1.000	NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3
6	Q9BQ02	0.0	587	482	0.403	0.593	Q9BQ02_HUMAN NCL protein OS=Homo sapiens OX=9606 PE=1 SV=1
7	B8JLQ3	8.08e-133	410	704	0.328	0.331	B8JLQ3_DANRE Nucleolin OS=Danio rerio OX=7955 GN=wu:fa12d03 PE=1 SV=1
8	F1R6L6	8.32e-133	410	705	0.328	0.330	F1R6L6_DANRE Nucleolin OS=Danio rerio OX=7955 GN=fa12d03 PE=1 SV=1
9	O04319	7.51e-22	102	537	0.145	0.192	PABP6_ARATH Polyadenylate-binding protein 6 OS=Arabidopsis thaliana OX=3702 GN=PAB6 PE=2 SV=1
10	P42731	1.06e-20	99.4	629	0.142	0.161	PABP2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana OX=3702 GN=PAB2 PE=1 SV=1
11	Q13310	3.32e-20	97.8	644	0.139	0.154	PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
12	B1ANR0	5.56e-20	96.7	615	0.139	0.161	B1ANR0_HUMAN Polyadenylate-binding protein OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
13	A2A5N3	3.14e-19	94.4	607	0.127	0.148	A2A5N3_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
14	B2RXY9	3.64e-19	94.4	607	0.127	0.148	B2RXY9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc1l PE=2 SV=1
15	P32588	4.27e-19	93.2	453	0.070	0.110	PUB1_YEAST Nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUB1 PE=1 SV=4
16	Q6PHQ9	1.03e-18	92.8	660	0.137	0.147	Q6PHQ9_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
17	Q99LF8	1.03e-18	92.8	660	0.137	0.147	Q99LF8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=2 SV=1
18	A3KFU8	1.12e-18	92.8	644	0.137	0.151	A3KFU8_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
19	A3KFU5	1.89e-18	92.0	631	0.137	0.154	A3KFU5_MOUSE Polyadenylate-binding protein OS=Mus musculus OX=10090 GN=Pabpc4 PE=1 SV=1
20	F1QB54	2.32e-18	91.7	634	0.137	0.153	PABPA_DANRE Polyadenylate-binding protein 1A OS=Danio rerio OX=7955 GN=pabpc1a PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09026 CENP-B_dimeris	64	15.5	Centromere protein B dimerisation domain
2	PF03880 DbpA	85	14.6	DbpA RNA binding domain
3	PF11608 MARF1_RRM1	85	14.7	MARF1, RNA recognition motif 1
4	PF14605 Nup35_RRM_2	3.7e+02	12.5	Nup53/35/40-type RNA recognition motif
5	PF00076 RRM_1	2.5e-54	192.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF16367 RRM_7	15	17.1	RNA recognition motif
7	PF11835 RRM_8	0.26	22.8	RRM-like domain
8	PF16842 RRM_occluded	15	16.9	Occluded RNA-recognition motif
9	PF17799 RRM_Rrp7	57	15.0	Rrp7 RRM-like N-terminal domain
10	PF11767 SET_assoc	4.9e+02	11.8	Histone lysine methyltransferase SET associated
11	PF19977 xRRM	6.6	18.4	xRRM domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000318195

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000296930	0.999	Nucleophosmin
2	9606.ENSP00000354522	0.997	DNA topoisomerase 1
3	9606.ENSP00000221801	0.995	rRNA 2'-O-methyltransferase fibrillarin
4	9606.ENSP00000347665	0.991	Collagen alpha-1(XVIII) chain
5	9606.ENSP00000269305	0.989	Cellular tumor antigen p53
6	9606.ENSP00000339328	0.983	Urokinase plasminogen activator surface receptor
7	9606.ENSP00000385451	0.981	Midkine
8	9606.ENSP00000275493	0.977	Epidermal growth factor receptor
9	9606.ENSP00000479618	0.976	Myc proto-oncogene protein
10	9606.ENSP00000384302	0.974	WD repeat-containing protein 43
11	9606.ENSP00000262238	0.972	Transcriptional repressor protein YY1
12	9606.ENSP00000365439	0.972	Heterogeneous nuclear ribonucleoprotein K
13	9606.ENSP00000369757	0.966	40S ribosomal protein S6
14	9606.ENSP00000370589	0.965	Nucleolar protein 56
15	9606.ENSP00000263209	0.963	Microprocessor complex subunit DGCR8
16	9606.ENSP00000264279	0.961	Nucleolar protein 58
17	9606.ENSP00000314193	0.956	WD repeat-containing protein 75
18	9606.ENSP00000335153	0.956	Heat shock protein HSP 90-alpha
19	9606.ENSP00000309572	0.954	Telomerase reverse transcriptase
20	9606.ENSP00000341885	0.954	Ribosomal protein S2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.999	RNA binding
GO:0003729	0.994	mRNA binding
GO:0043565	0.991	sequence-specific DNA binding
GO:0042162	0.981	telomeric DNA binding
GO:0019899	0.979	enzyme binding
GO:0048027	0.964	mRNA 5'-UTR binding
GO:0140297	0.961	DNA-binding transcription factor binding
GO:0042802	0.838	identical protein binding
GO:0044547	0.684	DNA topoisomerase binding
GO:0003697	0.433	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.982	cellular process
GO:0019222	0.978	regulation of metabolic process
GO:0060255	0.969	regulation of macromolecule metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0031323	0.965	regulation of cellular metabolic process
GO:0048518	0.964	positive regulation of biological process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0010604	0.899	positive regulation of macromolecule metabolic process
GO:0048523	0.897	negative regulation of cellular process
GO:0010468	0.897	regulation of gene expression
GO:0019219	0.897	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.879	regulation of RNA metabolic process
GO:2000112	0.863	regulation of cellular macromolecule biosynthetic process
GO:0034248	0.861	regulation of amide metabolic process
GO:0048522	0.856	positive regulation of cellular process
GO:0071704	0.845	organic substance metabolic process
GO:0044238	0.836	primary metabolic process
GO:0032501	0.821	multicellular organismal process
GO:0010608	0.820	post-transcriptional regulation of gene expression
GO:0044237	0.812	cellular metabolic process
GO:0006807	0.811	nitrogen compound metabolic process
GO:0032502	0.795	developmental process
GO:0048856	0.790	anatomical structure development
GO:0043170	0.788	macromolecule metabolic process
GO:0051172	0.743	negative regulation of nitrogen compound metabolic process
GO:0051173	0.707	positive regulation of nitrogen compound metabolic process
GO:0010605	0.697	negative regulation of macromolecule metabolic process
GO:0006417	0.692	regulation of translation
GO:0010557	0.690	positive regulation of macromolecule biosynthetic process
GO:0031325	0.686	positive regulation of cellular metabolic process
GO:0031324	0.682	negative regulation of cellular metabolic process
GO:0031328	0.662	positive regulation of cellular biosynthetic process
GO:0045935	0.662	positive regulation of nucleobase-containing compound metabolic process
GO:0006355	0.658	regulation of DNA-templated transcription
GO:0051254	0.613	positive regulation of RNA metabolic process
GO:0007275	0.612	multicellular organism development
GO:0045893	0.604	positive regulation of DNA-templated transcription
GO:0140747	0.580	regulation of ncRNA transcription
GO:0034641	0.575	cellular nitrogen compound metabolic process
GO:0006356	0.569	regulation of transcription by RNA polymerase I
GO:0009890	0.564	negative regulation of biosynthetic process
GO:0072359	0.519	circulatory system development
GO:0050896	0.468	response to stimulus
GO:0010558	0.466	negative regulation of macromolecule biosynthetic process
GO:0071840	0.436	cellular component organization or biogenesis
GO:0031327	0.418	negative regulation of cellular biosynthetic process
GO:0035295	0.413	tube development
GO:0090304	0.406	nucleic acid metabolic process
GO:0010467	0.396	gene expression
GO:0009653	0.376	anatomical structure morphogenesis
GO:0016070	0.375	RNA metabolic process
GO:0051248	0.353	negative regulation of protein metabolic process
GO:0045943	0.353	positive regulation of transcription by RNA polymerase I
GO:0048646	0.326	anatomical structure formation involved in morphogenesis
GO:0010629	0.321	negative regulation of gene expression
GO:0051716	0.307	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005730	0.999	nucleolus
GO:0005694	0.996	chromosome
GO:0036464	0.979	cytoplasmic ribonucleoprotein granule
GO:0032991	0.951	protein-containing complex
GO:0005829	0.922	cytosol
GO:0016020	0.552	membrane
GO:0043230	0.459	extracellular organelle
GO:1903561	0.450	extracellular vesicle
GO:0005615	0.412	extracellular space
GO:0071944	0.344	cell periphery
GO:1990904	0.316	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]