StarFunc result for job id P19388

User Input

>input (210 residues)
MDDEEETYRLWKIRKTIMQLCHDRGYLVTQDELDQTLEEFKAQSGDKPSEGRPRRTDLTV
LVAHNDDPTDQMFVFFPEEPKVGIKTIKVYCQRMQEENITRALIVVQQGMTPSAKQSLVD
MAPKYILEQFLQQELLINITEHELVPEHVVMTKEEVTELLARYKLRENQLPRIQAGDPVA
RYFGIKRGQVVKIIRPSETAGRYITYRLVQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E5KT65	0.999	0.999	3.950E-45	210	1.000	1.000	E5KT65.pdb.gz	E5KT65_HUMAN DNA-directed RNA polymerase II subunit E OS=Homo sapiens OX=9606 PE=3 SV=1
2	PDB:7d58E	0.956	0.956	6.675E-36	210	1.000	1.000	7d58E.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
3	AFDB:A0A087WVZ9	0.592	0.671	8.302E-34	184	0.862	0.984	A0A087WVZ9.pdb.gz	A0A087WVZ9_HUMAN DNA-directed RNA polymerase II subunit E OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=1
4	AFDB:O81098	0.944	0.967	3.634E-30	205	0.529	0.541	O81098.pdb.gz	RPB5A_ARATH DNA-directed RNA polymerases II and IV subunit 5A OS=Arabidopsis thaliana OX=3702 GN=NRPB5A PE=1 SV=1
5	PDB:6drdE	0.856	0.970	1.132E-28	185	0.862	0.978	6drdE.pdb.gz	Architecture of Pol II(G) and molecular mechanism of transcription regulation by Gdown1.
6	AFDB:Q09191	0.935	0.935	3.663E-27	210	0.429	0.429	Q09191.pdb.gz	RPAB1_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb5 PE=1 SV=1
7	AFDB:P20434	0.923	0.902	3.985E-26	215	0.443	0.433	P20434.pdb.gz	RPAB1_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB5 PE=1 SV=1
8	AFDB:Q9M1J2	0.887	0.841	2.461E-23	222	0.310	0.293	Q9M1J2.pdb.gz	RPE5A_ARATH DNA-directed RNA polymerase V subunit 5A OS=Arabidopsis thaliana OX=3702 GN=NRPE5A PE=1 SV=1
9	AFDB:Q9ZVB9	0.916	0.883	9.460E-23	218	0.290	0.280	Q9ZVB9.pdb.gz	RPD5B_ARATH DNA-directed RNA polymerases IV and V subunit 5B OS=Arabidopsis thaliana OX=3702 GN=NRPD5B PE=1 SV=1
10	AFDB:Q9M1H8	0.880	0.796	1.452E-22	233	0.305	0.275	Q9M1H8.pdb.gz	RPE5C_ARATH DNA-directed RNA polymerase V subunit 5C OS=Arabidopsis thaliana OX=3702 GN=NRPE5C PE=2 SV=1
11	PDB:6cnbE	0.906	0.886	1.876E-22	215	0.452	0.442	6cnbE.pdb.gz	Structural visualization of RNA polymerase III transcription machineries.
12	PDB:7eu1E	0.891	0.939	8.149E-22	199	0.505	0.533	7eu1E.pdb.gz	Pol IV and RDR2: A two-RNA-polymerase machine that produces double-stranded RNA.
13	AFDB:Q388R5	0.898	0.863	1.718E-20	219	0.348	0.333	Q388R5.pdb.gz	Q388R5_TRYB2 DNA-directed RNA polymerases II subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0110 PE=3 SV=1
14	PDB:3h0gE	0.907	0.919	4.094E-20	207	0.424	0.430	3h0gE.pdb.gz	Schizosacharomyces pombe RNA polymerase II at 3.6-A resolution.
15	PDB:2e2hE	0.831	0.901	1.340E-18	193	0.386	0.420	2e2hE.pdb.gz	Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
16	AFDB:Q388R6	0.817	0.585	6.166E-15	299	0.271	0.191	Q388R6.pdb.gz	Q388R6_TRYB2 DNA-directed RNA polymerase II, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0120 PE=4 SV=1
17	PDB:7ok0H	0.342	0.898	5.396E-8	78	0.152	0.410	7ok0H.pdb.gz	Structural basis of RNA polymerase inhibition by viral and host factors.
18	PDB:4aybH	0.340	0.914	1.351E-7	76	0.143	0.395	4aybH.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
19	PDB:7qcdE	0.168	0.146	4.290E-2	261	0.124	0.100	7qcdE.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
20	PDB:2h63D	0.189	0.148	1.649E-1	285	0.081	0.060	2h63D.pdb.gz	Crystal Structure of Human Biliverdin Reductase A

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E5KT65	2.91e-156	432	210	1.000	1.000	E5KT65_HUMAN DNA-directed RNA polymerase II subunit E OS=Homo sapiens OX=9606 PE=3 SV=1
2	P19388	2.91e-156	432	210	1.000	1.000	RPAB1_HUMAN DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=4
3	Q80UW8	4.58e-154	427	210	0.986	0.986	RPAB1_MOUSE DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Mus musculus OX=10090 GN=Polr2e PE=1 SV=1
4	Q2T9T3	6.31e-153	424	210	0.986	0.986	RPAB1_BOVIN DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Bos taurus OX=9913 GN=POLR2E PE=1 SV=1
5	A0A087WVZ9	9.92e-129	362	184	0.867	0.989	A0A087WVZ9_HUMAN DNA-directed RNA polymerase II subunit E OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=1
6	A0A087WWX0	1.72e-92	268	134	0.633	0.993	A0A087WWX0_HUMAN RNA polymerase II, I and III subunit E (Fragment) OS=Homo sapiens OX=9606 GN=POLR2E PE=1 SV=1
7	O81098	3.97e-78	234	205	0.533	0.546	RPB5A_ARATH DNA-directed RNA polymerases II and IV subunit 5A OS=Arabidopsis thaliana OX=3702 GN=NRPB5A PE=1 SV=1
8	Q09191	6.18e-59	186	210	0.438	0.438	RPAB1_SCHPO DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb5 PE=1 SV=1
9	P20434	1.43e-58	185	215	0.452	0.442	RPAB1_YEAST DNA-directed RNA polymerases I, II, and III subunit RPABC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB5 PE=1 SV=1
10	Q9M1J2	1.45e-32	119	222	0.319	0.302	RPE5A_ARATH DNA-directed RNA polymerase V subunit 5A OS=Arabidopsis thaliana OX=3702 GN=NRPE5A PE=1 SV=1
11	Q388R5	7.20e-31	114	219	0.362	0.347	Q388R5_TRYB2 DNA-directed RNA polymerases II subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0110 PE=3 SV=1
12	Q9ZVB9	2.35e-30	113	218	0.305	0.294	RPD5B_ARATH DNA-directed RNA polymerases IV and V subunit 5B OS=Arabidopsis thaliana OX=3702 GN=NRPD5B PE=1 SV=1
13	Q9M1H8	2.43e-29	110	233	0.314	0.283	RPE5C_ARATH DNA-directed RNA polymerase V subunit 5C OS=Arabidopsis thaliana OX=3702 GN=NRPE5C PE=2 SV=1
14	P11521	3.50e-14	67.4	84	0.152	0.381	RPO5_SULAC DNA-directed RNA polymerase subunit Rpo5 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo5 PE=1 SV=2
15	B8YB60	1.72e-11	60.1	84	0.138	0.345	RPO5_SACSH DNA-directed RNA polymerase subunit Rpo5 OS=Saccharolobus shibatae OX=2286 GN=rpo5 PE=1 SV=1
16	Q980Q9	2.35e-11	59.7	84	0.138	0.345	RPO5_SACS2 DNA-directed RNA polymerase subunit Rpo5 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo5 PE=1 SV=1
17	Q388R6	5.57e-11	62.8	299	0.257	0.181	Q388R6_TRYB2 DNA-directed RNA polymerase II, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.389.0120 PE=4 SV=1
18	P0CAX5	0.14	35.4	802	0.095	0.025	OPHN1_RAT Oligophrenin-1 OS=Rattus norvegicus OX=10116 GN=Ophn1 PE=1 SV=1
19	Q99J31	0.25	34.7	802	0.095	0.025	OPHN1_MOUSE Oligophrenin-1 OS=Mus musculus OX=10090 GN=Ophn1 PE=1 SV=1
20	O60890	0.29	34.3	802	0.090	0.024	OPHN1_HUMAN Oligophrenin-1 OS=Homo sapiens OX=9606 GN=OPHN1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10415 FumaraseC_C	2.7e+02	13.3	Fumarase C C-terminus
2	PF01191 RNA_pol_Rpb5_C	2.8e-31	118.5	RNA polymerase Rpb5, C-terminal domain
3	PF03871 RNA_pol_Rpb5_N	2.1e-29	113.3	RNA polymerase Rpb5, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000478303

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219252	0.999	DNA-directed RNA polymerase II subunit RPB3
2	9606.ENSP00000221859	0.999	DNA-directed RNA polymerase II subunit RPB9
3	9606.ENSP00000228347	0.999	DNA-directed RNA polymerase III subunit RPC2
4	9606.ENSP00000263857	0.999	DNA-directed RNA polymerase I subunit RPA1
5	9606.ENSP00000272645	0.999	DNA-directed RNA polymerase II subunit RPB4
6	9606.ENSP00000292614	0.999	DNA-directed RNA polymerase II subunit RPB11-a
7	9606.ENSP00000293860	0.999	DNA-directed RNA polymerase III subunit RPC10
8	9606.ENSP00000301788	0.999	DNA-directed RNA polymerase II subunit RPB7
9	9606.ENSP00000302478	0.999	DNA-directed RNA polymerases I and III subunit RPAC2
10	9606.ENSP00000324124	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC5
11	9606.ENSP00000331111	0.999	DNA-directed RNA polymerase I subunit RPA12
12	9606.ENSP00000340823	0.999	General transcription factor IIF subunit 2
13	9606.ENSP00000342889	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC4
14	9606.ENSP00000359531	0.999	Transcription initiation factor IIB
15	9606.ENSP00000361446	0.999	DNA-directed RNA polymerase III subunit RPC1
16	9606.ENSP00000361465	0.999	DNA-directed RNA polymerases I and III subunit RPAC1
17	9606.ENSP00000366828	0.999	DNA-directed RNA polymerase III subunit RPC6
18	9606.ENSP00000370625	0.999	DNA-directed RNA polymerase II subunit RPB2
19	9606.ENSP00000380904	0.999	DNA-directed RNA polymerase III subunit RPC4
20	9606.ENSP00000403852	0.999	DNA-directed RNA polymerases I, II, and III subunit RPABC2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003899	1.000	DNA-directed 5'-3' RNA polymerase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.995	cellular process
GO:0090304	0.986	nucleic acid metabolic process
GO:0006366	0.984	transcription by RNA polymerase II
GO:0065007	0.421	biological regulation
GO:0050794	0.399	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.980	protein-containing complex
GO:0005829	0.902	cytosol
GO:1990234	0.857	transferase complex
GO:0140513	0.833	nuclear protein-containing complex
GO:0140535	0.783	intracellular protein-containing complex
GO:0061695	0.703	transferase complex, transferring phosphorus-containing groups
GO:0000428	0.676	DNA-directed RNA polymerase complex
GO:0055029	0.462	nuclear DNA-directed RNA polymerase complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	1.000	DNA-directed RNA polymerase.

[back to server]