StarFunc result for job id P19404

User Input

>input (249 residues)
MFFSAALRARAAGLTAHWGRHVRNLHKTVMQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P04394	0.931	0.931	1.897E-44	249	0.964	0.964	P04394.pdb.gz	NDUV2_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Bos taurus OX=9913 GN=NDUFV2 PE=1 SV=3
2	PDB:7b93E	0.849	0.982	7.208E-37	215	0.827	0.958	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
3	AFDB:Q7JYN2	0.865	0.801	1.851E-33	269	0.643	0.595	Q7JYN2.pdb.gz	Q7JYN2_DROME GH08937p (Fragment) OS=Drosophila melanogaster OX=7227 GN=ND-24 PE=2 SV=1
4	AFDB:A0A1D8PG37	0.847	0.867	5.447E-28	243	0.498	0.510	A0A1D8PG37.pdb.gz	A0A1D8PG37_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C200400CA PE=3 SV=1
5	AFDB:O22769	0.810	0.791	4.974E-26	255	0.426	0.416	O22769.pdb.gz	NDUV2_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g02580 PE=1 SV=3
6	PDB:7a23B	0.799	0.906	1.163E-23	219	0.422	0.479	7a23B.pdb.gz	Specific features and assembly of the plant mitochondrial complex I revealed by cryo-EM.
7	AFDB:Q582M4	0.811	0.742	2.396E-23	273	0.418	0.381	Q582M4.pdb.gz	Q582M4_TRYB2 NADH-ubiquinone oxidoreductase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.33N13.230 PE=3 SV=1
8	AFDB:P0AFD1	0.601	0.886	2.143E-14	166	0.225	0.337	P0AFD1.pdb.gz	NUOE_ECOLI NADH-quinone oxidoreductase subunit E OS=Escherichia coli (strain K12) OX=83333 GN=nuoE PE=1 SV=1
9	AFDB:Q46505	0.508	0.704	2.561E-14	171	0.197	0.287	Q46505.pdb.gz	HNDA_SOLFR NADP-reducing hydrogenase subunit HndA OS=Solidesulfovibrio fructosivorans OX=878 GN=hndA PE=1 SV=1
10	PDB:7awtE	0.600	0.944	6.649E-13	156	0.217	0.346	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
11	AFDB:O13691	0.544	0.813	7.887E-10	162	0.193	0.296	O13691.pdb.gz	NDUV2_SCHPO NADH-ubiquinone oxidoreductase 24 kDa subunit homolog C11E3.12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11E3.12 PE=3 SV=1
12	PDB:5gu6A	0.234	0.164	2.508E-2	377	0.064	0.042	5gu6A.pdb.gz
13	PDB:2r2jA	0.233	0.188	6.884E-2	328	0.064	0.049	2r2jA.pdb.gz
14	PDB:6cp6Y	0.169	0.189	8.227E-2	188	0.084	0.112	6cp6Y.pdb.gz	High-resolution cryo-EM analysis of the yeast ATP synthase in a lipid membrane.
15	PDB:8apaM1	0.176	0.183	1.107E-1	234	0.116	0.124	8apaM1.pdb.gz	An ancestral interaction module promotes oligomerization in divergent mitochondrial ATP synthases.
16	PDB:3bbyA	0.194	0.244	1.175E-1	191	0.052	0.068	3bbyA.pdb.gz	Crystal structure of glutathione S-transferase (NP_416804.1) from Escherichia coli K12 at 1.85 A resolution
17	PDB:6gd1A	0.230	0.291	1.890E-1	190	0.048	0.063	6gd1A.pdb.gz
18	PDB:3j6b4	0.200	0.319	2.005E-1	138	0.056	0.101	3j6b4.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
19	AFDB:A0A1D8PH08	0.136	0.190	5.240E-1	150	0.100	0.167	A0A1D8PH08.pdb.gz	A0A1D8PH08_CANAL Cytochrome c oxidase subunit 6, mitochondrial OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=COX6 PE=3 SV=1
20	AFDB:O15499	0.117	0.138	5.240E-1	205	0.092	0.112	O15499.pdb.gz	GSC2_HUMAN Homeobox protein goosecoid-2 OS=Homo sapiens OX=9606 GN=GSC2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19404	0.0	520	249	1.000	1.000	NDUV2_HUMAN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2
2	Q9D6J6	5.55e-177	488	248	0.928	0.931	NDUV2_MOUSE NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Mus musculus OX=10090 GN=Ndufv2 PE=1 SV=2
3	P04394	8.38e-175	482	249	0.964	0.964	NDUV2_BOVIN NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Bos taurus OX=9913 GN=NDUFV2 PE=1 SV=3
4	Q9VX36	3.07e-116	334	242	0.622	0.640	Q9VX36_DROME NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A OS=Drosophila melanogaster OX=7227 GN=ND-24 PE=1 SV=1
5	Q7JYN2	3.41e-116	335	269	0.622	0.576	Q7JYN2_DROME GH08937p (Fragment) OS=Drosophila melanogaster OX=7227 GN=ND-24 PE=2 SV=1
6	A0A1D8PG37	1.66e-77	236	243	0.466	0.477	A0A1D8PG37_CANAL Uncharacterized protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C200400CA PE=3 SV=1
7	O22769	3.07e-71	220	255	0.430	0.420	NDUV2_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g02580 PE=1 SV=3
8	Q582M4	5.54e-58	187	273	0.390	0.355	Q582M4_TRYB2 NADH-ubiquinone oxidoreductase, mitochondrial, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.33N13.230 PE=3 SV=1
9	Q46505	2.88e-27	105	171	0.197	0.287	HNDA_SOLFR NADP-reducing hydrogenase subunit HndA OS=Solidesulfovibrio fructosivorans OX=878 GN=hndA PE=1 SV=1
10	P0AFD1	8.32e-27	103	166	0.221	0.331	NUOE_ECOLI NADH-quinone oxidoreductase subunit E OS=Escherichia coli (strain K12) OX=83333 GN=nuoE PE=1 SV=1
11	O13691	1.77e-14	70.9	162	0.205	0.315	NDUV2_SCHPO NADH-ubiquinone oxidoreductase 24 kDa subunit homolog C11E3.12, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC11E3.12 PE=3 SV=1
12	Q94K06	2.2	32.0	605	0.076	0.031	Q94K06_ARATH Polynucleotide adenylyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=At1g22660 PE=1 SV=1
13	P0A8V2	2.7	32.0	1342	0.120	0.022	RPOB_ECOLI DNA-directed RNA polymerase subunit beta OS=Escherichia coli (strain K12) OX=83333 GN=rpoB PE=1 SV=1
14	E9Q2T3	3.2	31.6	3126	0.108	0.009	E9Q2T3_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
15	Q3V5L4	3.2	31.6	3126	0.108	0.009	Q3V5L4_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnxb PE=2 SV=1
16	O35452	3.5	31.6	4006	0.108	0.007	O35452_MOUSE Tenascin X OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
17	A0A571BG59	3.6	31.6	4114	0.108	0.007	A0A571BG59_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
18	A0A5F8MPH8	3.6	31.6	4356	0.108	0.006	A0A5F8MPH8_MOUSE Tenascin XB OS=Mus musculus OX=10090 GN=Tnxb PE=1 SV=1
19	O54796	3.6	31.6	4114	0.108	0.007	O54796_MOUSE Tenascin-X OS=Mus musculus OX=10090 GN=Tnx PE=3 SV=1
20	S5RNB2	4.4	31.2	1169	0.056	0.012	S5RNB2_SALSA Tyrosine-protein kinase OS=Salmo salar OX=8030 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01257 2Fe-2S_thioredx	4.8e-62	219.5	Thioredoxin-like [2Fe-2S] ferredoxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000184266	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4
2	9606.ENSP00000215565	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
3	9606.ENSP00000233627	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
4	9606.ENSP00000252102	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
5	9606.ENSP00000252711	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial
6	9606.ENSP00000259037	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
7	9606.ENSP00000263774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
8	9606.ENSP00000266544	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
9	9606.ENSP00000268668	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
10	9606.ENSP00000274137	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
11	9606.ENSP00000276689	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
12	9606.ENSP00000296684	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial
13	9606.ENSP00000299166	0.999	NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial
14	9606.ENSP00000301457	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
15	9606.ENSP00000315774	0.999	NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial
16	9606.ENSP00000322450	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
17	9606.ENSP00000330737	0.999	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
18	9606.ENSP00000346196	0.999	NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
19	9606.ENSP00000354687	0.999	NADH-ubiquinone oxidoreductase chain 1
20	9606.ENSP00000354813	0.999	NADH-ubiquinone oxidoreductase chain 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0008137	0.999	NADH dehydrogenase (ubiquinone) activity
GO:0043167	0.672	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0008152	0.995	metabolic process
GO:0006119	0.989	oxidative phosphorylation
GO:0022904	0.982	respiratory electron transport chain
GO:0042775	0.970	mitochondrial ATP synthesis coupled electron transport
GO:0019646	0.963	aerobic electron transport chain
GO:0006120	0.948	mitochondrial electron transport, NADH to ubiquinone
GO:0032501	0.841	multicellular organismal process
GO:0048856	0.549	anatomical structure development
GO:0007275	0.507	multicellular organism development
GO:0048731	0.419	system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0098798	0.997	mitochondrial protein-containing complex
GO:0005743	0.997	mitochondrial inner membrane
GO:1990204	0.995	oxidoreductase complex
GO:0098796	0.985	membrane protein complex
GO:0005747	0.980	mitochondrial respiratory chain complex I
GO:0043233	0.589	organelle lumen
GO:0070013	0.576	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29091	0.999	a ubiquinone + 5 H(+)(in) + NADH = a ubiquinol + 4 H(+)(out) + NAD(+)
EC:7.1.1.2	0.999	NADH:ubiquinone reductase (H(+)-translocating).

[back to server]