StarFunc result for job id P19419

User Input

>input (428 residues)
MDPSVTLWQFLLQLLREQGNGHIISWTSRDGGEFKLVDAEEVARLWGLRKNKTNMNYDKL
SRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEDCPPQPEVSVTSTMPNVAPAAIH
AAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAVV
LPSAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPGL
GRALPPEVKVEGPKEELEVAGERGFVPETTKAEPEVPPQEGVPARLPAVVMDTAGQAGGH
AASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPTH
TLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPVV
LSPGPQKP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R1A7	0.354	0.354	4.835E-58	428	1.000	1.000	A0A024R1A7.pdb.gz
2	AFDB:P41969	0.394	0.394	2.558E-50	429	0.855	0.853	P41969.pdb.gz	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
3	AFDB:P41971	0.270	0.282	3.099E-22	409	0.367	0.384	P41971.pdb.gz	ELK3_MOUSE ETS domain-containing protein Elk-3 OS=Mus musculus OX=10090 GN=Elk3 PE=2 SV=3
4	AFDB:A0A024R985	0.258	0.256	6.362E-22	431	0.379	0.376	A0A024R985.pdb.gz
5	AFDB:G5EDL0	0.200	0.194	1.183E-14	441	0.290	0.281	G5EDL0.pdb.gz	G5EDL0_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lin-1 PE=2 SV=1
6	AFDB:Q99607	0.210	0.136	1.493E-12	663	0.252	0.163	Q99607.pdb.gz	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
7	AFDB:G3V9V2	0.205	0.143	2.871E-12	615	0.241	0.167	G3V9V2.pdb.gz	G3V9V2_RAT E74 like ETS transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Elf1 PE=3 SV=1
8	AFDB:Q9EQY2	0.216	0.162	4.845E-12	579	0.222	0.164	Q9EQY2.pdb.gz
9	AFDB:P32519	0.212	0.149	6.293E-12	619	0.220	0.152	P32519.pdb.gz	ELF1_HUMAN ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1 PE=1 SV=2
10	AFDB:P70459	0.194	0.152	8.174E-12	551	0.292	0.227	P70459.pdb.gz	ERF_MOUSE ETS domain-containing transcription factor ERF OS=Mus musculus OX=10090 GN=Erf PE=1 SV=1
11	PDB:3i54D	0.129	0.218	1.046E-1	228	0.026	0.048	3i54D.pdb.gz	Structural Insights into the Mechanism of the Allosteric Transitions of Mycobacterium tuberculosis cAMP Receptor Protein.
12	PDB:1ldjA	0.112	0.071	1.117E-1	725	0.023	0.014	1ldjA.pdb.gz	Structure of the Cul1-Rbx1-Skp1-F boxSkp2 SCF ubiquitin ligase complex.
13	PDB:4byyA	0.134	0.236	1.549E-1	226	0.033	0.062	4byyA.pdb.gz
14	PDB:6w6wC	0.102	0.126	5.727E-1	323	0.019	0.025	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
15	PDB:1u5tA	0.110	0.189	6.114E-1	213	0.021	0.042	1u5tA.pdb.gz
16	PDB:2zcwA	0.125	0.238	6.528E-1	194	0.016	0.036	2zcwA.pdb.gz
17	PDB:4a0kA	0.107	0.069	6.969E-1	719	0.019	0.011	4a0kA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation.
18	PDB:4ev0D	0.115	0.214	7.439E-1	214	0.026	0.051	4ev0D.pdb.gz	Crystal Structure of T. thermophilius Catabolite Activator Protein
19	PDB:3cuqC	0.132	0.284	8.479E-1	173	0.021	0.052	3cuqC.pdb.gz
20	PDB:1ft9A	0.114	0.208	9.052E-1	210	0.026	0.052	1ft9A.pdb.gz	Structure of the CO sensing transcription activator CooA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4GTP4	0.0	706	427	0.860	0.862	ELK1_RAT ETS domain-containing protein Elk-1 OS=Rattus norvegicus OX=10116 GN=Elk1 PE=1 SV=1
2	P19419	0.0	846	428	1.000	1.000	ELK1_HUMAN ETS domain-containing protein Elk-1 OS=Homo sapiens OX=9606 GN=ELK1 PE=1 SV=2
3	P41969	0.0	677	429	0.850	0.848	ELK1_MOUSE ETS domain-containing protein Elk-1 OS=Mus musculus OX=10090 GN=Elk1 PE=1 SV=3
4	P41971	2.70e-50	177	409	0.222	0.232	ELK3_MOUSE ETS domain-containing protein Elk-3 OS=Mus musculus OX=10090 GN=Elk3 PE=2 SV=3
5	P41970	1.63e-44	161	407	0.196	0.206	ELK3_HUMAN ETS domain-containing protein Elk-3 OS=Homo sapiens OX=9606 GN=ELK3 PE=1 SV=2
6	P28324	2.40e-41	154	431	0.217	0.216	ELK4_HUMAN ETS domain-containing protein Elk-4 OS=Homo sapiens OX=9606 GN=ELK4 PE=1 SV=3
7	G5EDL0	1.50e-34	135	441	0.136	0.132	G5EDL0_CAEEL ETS domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=lin-1 PE=2 SV=1
8	Q9PUQ1	1.50e-30	125	494	0.126	0.109	ETV4_DANRE ETS translocation variant 4 OS=Danio rerio OX=7955 GN=etv4 PE=1 SV=2
9	F1Q6X6	1.91e-30	125	522	0.126	0.103	F1Q6X6_DANRE ETS translocation variant 5 isoform 2 OS=Danio rerio OX=7955 GN=etv5 PE=3 SV=3
10	P28322	4.04e-30	123	485	0.124	0.109	ETV4_MOUSE ETS translocation variant 4 OS=Mus musculus OX=10090 GN=Etv4 PE=2 SV=2
11	B7Z5F4	4.09e-30	122	430	0.124	0.123	B7Z5F4_HUMAN ETS variant transcription factor 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=1
12	P43268	5.10e-30	123	484	0.124	0.110	ETV4_HUMAN ETS translocation variant 4 OS=Homo sapiens OX=9606 GN=ETV4 PE=1 SV=3
13	F1QK52	8.88e-30	123	524	0.124	0.101	F1QK52_DANRE ETS variant transcription factor 5b OS=Danio rerio OX=7955 GN=cb805 PE=3 SV=1
14	A3FEM2	1.09e-29	117	235	0.133	0.243	FEV_DANRE Protein FEV OS=Danio rerio OX=7955 GN=fev PE=2 SV=1
15	Q9CXC9	1.63e-29	122	510	0.121	0.102	ETV5_MOUSE ETS translocation variant 5 OS=Mus musculus OX=10090 GN=Etv5 PE=2 SV=1
16	P29776	1.84e-29	121	475	0.133	0.120	ETS6_DROME DNA-binding protein D-ETS-6 OS=Drosophila melanogaster OX=7227 GN=Ets21C PE=2 SV=2
17	A0A8I6AQT3	1.92e-29	122	528	0.121	0.098	A0A8I6AQT3_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1
18	P50549	1.93e-29	121	477	0.124	0.111	ETV1_HUMAN ETS translocation variant 1 OS=Homo sapiens OX=9606 GN=ETV1 PE=1 SV=2
19	P41164	2.09e-29	121	477	0.124	0.111	ETV1_MOUSE ETS translocation variant 1 OS=Mus musculus OX=10090 GN=Etv1 PE=1 SV=1
20	D4AC56	2.28e-29	122	510	0.147	0.124	D4AC56_RAT ETS variant transcription factor 5 OS=Rattus norvegicus OX=10116 GN=Etv5 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00178 Ets	7.4e-32	120.8	Ets-domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483056

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215832	0.993	Mitogen-activated protein kinase 1
2	9606.ENSP00000263025	0.989	Mitogen-activated protein kinase 3
3	9606.ENSP00000265354	0.987	Serum response factor
4	9606.ENSP00000378974	0.973	Mitogen-activated protein kinase 8
5	9606.ENSP00000401678	0.959	Myocardin
6	9606.ENSP00000394560	0.948	Mitogen-activated protein kinase 9
7	9606.ENSP00000306245	0.947	Proto-oncogene c-Fos
8	9606.ENSP00000360266	0.928	Transcription factor AP-1
9	9606.ENSP00000229795	0.923	Mitogen-activated protein kinase 14
10	9606.ENSP00000239938	0.914	Early growth response protein 1
11	9606.ENSP00000408695	0.910	Protein kinase C alpha type
12	9606.ENSP00000368884	0.905	Ribosomal protein S6 kinase alpha-3
13	9606.ENSP00000242480	0.901	E3 SUMO-protein ligase EGR2
14	9606.ENSP00000445626	0.901	Early growth response protein 4
15	9606.ENSP00000305355	0.900	Protein kinase C beta type
16	9606.ENSP00000456226	0.900	Interferon induced transmembrane protein domain containing
17	9606.ENSP00000352157	0.865	Mitogen-activated protein kinase 10
18	9606.ENSP00000333685	0.855	Mitogen-activated protein kinase 11
19	9606.ENSP00000211287	0.818	Mitogen-activated protein kinase 13
20	9606.ENSP00000257981	0.818	Potassium voltage-gated channel subfamily H member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000981	0.999	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000987	0.999	cis-regulatory region sequence-specific DNA binding
GO:0000977	0.999	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000978	0.914	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0001228	0.894	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0019222	0.995	regulation of metabolic process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0045944	0.980	positive regulation of transcription by RNA polymerase II
GO:0009987	0.511	cellular process
GO:0050896	0.463	response to stimulus
GO:0008152	0.398	metabolic process
GO:0071704	0.334	organic substance metabolic process
GO:0043170	0.321	macromolecule metabolic process
GO:0051716	0.316	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.443	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]