StarFunc result for job id P19429

User Input

>input (210 residues)
MADGSSDAAREPRPAPAPIRRRSSNYRAYATEPHAKKKSKISASRKLQLKTLLLQIAKQE
LEREAEERRGEKGRALSTRCQPLELAGLGFAELQDLCRQLHARVDKVDEERYDIEAKVTK
NITEIADLTQKIFDLRGKFKRPTLRRVRISADAMMQALLGARAKESLDLRAHLKQVKKED
TEKENREVGDWRKNIDALSGMEGRKKKFES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P08057	0.797	0.790	1.691E-25	212	0.929	0.920	P08057.pdb.gz	TNNI3_BOVIN Troponin I, cardiac muscle OS=Bos taurus OX=9913 GN=TNNI3 PE=1 SV=2
2	PDB:7utlV	0.455	0.558	4.333E-18	170	0.810	1.000	7utlV.pdb.gz	Protein-Protein Docking Reveals Dynamic Interactions of Tropomyosin on Actin Filaments.
3	AFDB:A0A060VX54	0.614	0.588	8.106E-13	221	0.529	0.502	A0A060VX54.pdb.gz	A0A060VX54_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00080162001 PE=4 SV=1
4	AFDB:A0A060XSD9	0.612	0.637	3.018E-12	201	0.500	0.522	A0A060XSD9.pdb.gz	A0A060XSD9_ONCMY Troponin I, skeletal, slow c OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00049579001 PE=4 SV=1
5	AFDB:F8W4T8	0.467	0.535	8.957E-11	182	0.519	0.599	F8W4T8.pdb.gz
6	AFDB:P13413	0.445	0.495	1.357E-10	187	0.529	0.594	P13413.pdb.gz	TNNI1_RAT Troponin I, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni1 PE=1 SV=2
7	AFDB:A0A060W3E5	0.469	0.549	4.713E-10	178	0.467	0.551	A0A060W3E5.pdb.gz	A0A060W3E5_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065901001 PE=4 SV=1
8	AFDB:A0A060VTL6	0.502	0.583	1.081E-9	180	0.448	0.522	A0A060VTL6.pdb.gz	A0A060VTL6_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00077269001 PE=4 SV=1
9	AFDB:A0A2R8RX09	0.650	0.656	1.528E-9	208	0.452	0.457	A0A2R8RX09.pdb.gz
10	AFDB:A0A060Y5I6	0.407	0.573	2.118E-8	148	0.310	0.439	A0A060Y5I6.pdb.gz	A0A060Y5I6_ONCMY Troponin I type 1a (skeletal, slow) OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00003364001 PE=4 SV=1
11	AFDB:A0A060XBA6	0.477	0.577	2.433E-8	172	0.419	0.512	A0A060XBA6.pdb.gz	A0A060XBA6_ONCMY Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023680001 PE=4 SV=1
12	PDB:5nrlG	0.136	0.086	4.327	372	0.176	0.099	5nrlG.pdb.gz	Structure of a pre-catalytic spliceosome.
13	PDB:6wucH	0.203	0.234	4.969	179	0.105	0.123	6wucH.pdb.gz
14	PDB:6elzw	0.128	0.073	6.115	436	0.114	0.055	6elzw.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.
15	PDB:7n8oL	0.106	0.322	7.526	39	0.024	0.128	7n8oL.pdb.gz	High-resolution cryo-electron microscopy structure of photosystem II from the mesophilic cyanobacterium, Synechocystis sp. PCC 6803.
16	PDB:2lorA	0.100	0.168	9.925	108	0.052	0.102	2lorA.pdb.gz
17	PDB:7kpvC	0.116	0.055	9.925	487	0.086	0.037	7kpvC.pdb.gz
18	PDB:7mq8NE	0.105	0.203	9.925	100	0.076	0.160	7mq8NE.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P19429	2.20e-152	422	210	1.000	1.000	TNNI3_HUMAN Troponin I, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNI3 PE=1 SV=3
2	Q6FGX2	2.20e-152	422	210	1.000	1.000	Q6FGX2_HUMAN Troponin I, cardiac muscle OS=Homo sapiens OX=9606 GN=TNNI3 PE=1 SV=1
3	P48787	2.50e-130	367	211	0.929	0.924	TNNI3_MOUSE Troponin I, cardiac muscle OS=Mus musculus OX=10090 GN=Tnni3 PE=1 SV=2
4	P23693	3.70e-130	366	211	0.929	0.924	TNNI3_RAT Troponin I, cardiac muscle OS=Rattus norvegicus OX=10116 GN=Tnni3 PE=1 SV=2
5	P02646	7.72e-128	360	211	0.933	0.929	TNNI3_RABIT Troponin I, cardiac muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI3 PE=1 SV=2
6	P08057	3.76e-127	358	212	0.929	0.920	TNNI3_BOVIN Troponin I, cardiac muscle OS=Bos taurus OX=9913 GN=TNNI3 PE=1 SV=2
7	Q5PR62	3.43e-75	226	182	0.538	0.621	Q5PR62_DANRE Troponin I type 1b (Skeletal, slow) OS=Danio rerio OX=7955 GN=zgc:103458 PE=1 SV=1
8	D5M8S7	1.25e-73	223	189	0.533	0.593	D5M8S7_ONCMY Cardiac troponin I OS=Oncorhynchus mykiss OX=8022 PE=2 SV=1
9	A0A060VX54	1.57e-72	221	221	0.529	0.502	A0A060VX54_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00080162001 PE=4 SV=1
10	Q9WUZ5	6.97e-68	207	187	0.548	0.615	TNNI1_MOUSE Troponin I, slow skeletal muscle OS=Mus musculus OX=10090 GN=Tnni1 PE=1 SV=3
11	P13413	7.53e-68	207	187	0.548	0.615	TNNI1_RAT Troponin I, slow skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni1 PE=1 SV=2
12	P02643	2.83e-66	203	182	0.495	0.571	TNNI2_RABIT Troponin I, fast skeletal muscle OS=Oryctolagus cuniculus OX=9986 GN=TNNI2 PE=1 SV=3
13	P19237	3.36e-66	203	187	0.538	0.604	TNNI1_HUMAN Troponin I, slow skeletal muscle OS=Homo sapiens OX=9606 GN=TNNI1 PE=1 SV=3
14	P48788	1.15e-65	202	182	0.481	0.555	TNNI2_HUMAN Troponin I, fast skeletal muscle OS=Homo sapiens OX=9606 GN=TNNI2 PE=1 SV=2
15	A0A060XSD9	3.84e-65	201	201	0.490	0.512	A0A060XSD9_ONCMY Troponin I, skeletal, slow c OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00049579001 PE=4 SV=1
16	P27768	3.16e-62	193	182	0.490	0.566	TNNI2_RAT Troponin I, fast skeletal muscle OS=Rattus norvegicus OX=10116 GN=Tnni2 PE=1 SV=2
17	Q0D2W2	2.67e-60	188	176	0.457	0.545	Q0D2W2_DANRE Fast muscle troponin I OS=Danio rerio OX=7955 GN=hm:zehn0173 PE=1 SV=1
18	A0A060X4F4	7.04e-56	177	178	0.462	0.545	A0A060X4F4_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023684001 PE=4 SV=1
19	A0A060Y0V6	1.39e-54	174	180	0.471	0.550	A0A060Y0V6_ONCMY Troponin I, slow skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00034099001 PE=4 SV=1
20	A0A060W3E5	1.53e-51	166	178	0.462	0.545	A0A060W3E5_ONCMY Troponin I, fast skeletal muscle OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00065901001 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01544 CorA	5.6e+02	11.3	CorA-like Mg2+ transporter protein
2	PF12543 DUF3738	1.4e+02	14.1	Protein of unknown function (DUF3738)
3	PF06034 DUF919	56	15.0	Nucleopolyhedrovirus protein of unknown function (DUF919)
4	PF00992 Troponin	2.9e-44	161.9	Troponin
5	PF11636 Troponin-I_N	3.4e-12	57.4	Troponin I residues 1-32
6	PF08581 Tup_N	22	16.8	Tup N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000341838

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000232975	0.999	Troponin C, slow skeletal and cardiac muscles
2	9606.ENSP00000236918	0.999	Troponin T, cardiac muscle
3	9606.ENSP00000467176	0.997	Troponin T, slow skeletal muscle
4	9606.ENSP00000351022	0.995	Tropomyosin alpha-1 chain
5	9606.ENSP00000278317	0.991	Troponin T, fast skeletal muscle
6	9606.ENSP00000361636	0.979	Troponin C, skeletal muscle
7	9606.ENSP00000322251	0.975	Serine/threonine-protein kinase TNNI3K
8	9606.ENSP00000386041	0.969	Myosin-6
9	9606.ENSP00000290378	0.958	Actin, alpha cardiac muscle 1
10	9606.ENSP00000228841	0.947	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
11	9606.ENSP00000442795	0.946	Myosin-binding protein C, cardiac-type
12	9606.ENSP00000379210	0.944	Myosin light chain 3
13	9606.ENSP00000367542	0.928	Tropomyosin beta chain
14	9606.ENSP00000345230	0.922	Tropomyosin alpha-4 chain
15	9606.ENSP00000350310	0.920	Plasma membrane calcium-transporting ATPase 4
16	9606.ENSP00000357516	0.920	Tropomyosin alpha-3 chain
17	9606.ENSP00000355645	0.915	Actin, alpha skeletal muscle
18	9606.ENSP00000309591	0.910	cAMP-dependent protein kinase catalytic subunit alpha
19	9606.ENSP00000371331	0.910	Troponin I, fast skeletal muscle
20	9606.ENSP00000467141	0.909	Titin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0008092	0.978	cytoskeletal protein binding
GO:0030172	0.837	troponin C binding
GO:0098772	0.616	molecular function regulator activity
GO:0043167	0.571	ion binding
GO:0140678	0.502	molecular function inhibitor activity
GO:0043169	0.485	cation binding
GO:0046872	0.464	metal ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.998	biological regulation
GO:0032501	0.996	multicellular organismal process
GO:0050789	0.992	regulation of biological process
GO:0044057	0.975	regulation of system process
GO:0003008	0.971	system process
GO:0006936	0.963	muscle contraction
GO:0090257	0.961	regulation of muscle system process
GO:0006937	0.950	regulation of muscle contraction
GO:0006941	0.923	striated muscle contraction
GO:0009987	0.910	cellular process
GO:0048856	0.879	anatomical structure development
GO:0050794	0.866	regulation of cellular process
GO:0003013	0.858	circulatory system process
GO:0007275	0.828	multicellular organism development
GO:0072359	0.788	circulatory system development
GO:0048513	0.767	animal organ development
GO:0009653	0.727	anatomical structure morphogenesis
GO:0008015	0.711	blood circulation
GO:0007507	0.694	heart development
GO:0050896	0.562	response to stimulus
GO:0061061	0.543	muscle structure development
GO:0051716	0.448	cellular response to stimulus
GO:0060047	0.428	heart contraction
GO:0009888	0.388	tissue development
GO:0060048	0.386	cardiac muscle contraction
GO:0065009	0.370	regulation of molecular function
GO:0065008	0.353	regulation of biological quality
GO:0007154	0.325	cell communication
GO:0007517	0.305	muscle organ development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.998	protein-containing complex
GO:0030016	0.998	myofibril
GO:0005856	0.997	cytoskeleton
GO:0005829	0.995	cytosol
GO:0015629	0.991	actin cytoskeleton
GO:0030017	0.989	sarcomere
GO:0036379	0.983	myofilament
GO:0005865	0.969	striated muscle thin filament
GO:0005861	0.958	troponin complex
GO:0043231	0.756	intracellular membrane-bounded organelle
GO:0070013	0.428	intracellular organelle lumen
GO:0031981	0.418	nuclear lumen
GO:0005654	0.315	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]